Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 74971..75536 Replicon plasmid pKNA08
Accession NZ_CP118673
Organism Komagataeibacter nataicola strain DS12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LV564_RS00645 Protein ID WP_275881102.1
Coordinates 74971..75252 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LV564_RS00650 Protein ID WP_118963924.1
Coordinates 75249..75536 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LV564_RS00610 (LV564_00610) 70573..71232 + 660 WP_275881149.1 ParA family partition ATPase -
LV564_RS00615 (LV564_00615) 71260..71517 + 258 WP_081500038.1 hypothetical protein -
LV564_RS00620 (LV564_00620) 71557..72612 - 1056 WP_275881147.1 replication initiator protein A -
LV564_RS00625 (LV564_00625) 73661..73957 + 297 WP_275881099.1 BrnT family toxin -
LV564_RS00630 (LV564_00630) 73926..74270 + 345 WP_275881100.1 BrnA antitoxin family protein -
LV564_RS00635 (LV564_00635) 74324..74503 + 180 Protein_85 BrnT family toxin -
LV564_RS00640 (LV564_00640) 74463..74726 + 264 WP_275881101.1 BrnA antitoxin family protein -
LV564_RS00645 (LV564_00645) 74971..75252 - 282 WP_275881102.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LV564_RS00650 (LV564_00650) 75249..75536 - 288 WP_118963924.1 ribbon-helix-helix domain-containing protein Antitoxin
LV564_RS00655 (LV564_00655) 76270..76449 + 180 WP_019087453.1 type II toxin-antitoxin system HicA family toxin -
LV564_RS00660 (LV564_00660) 76460..76876 + 417 WP_275881103.1 type II toxin-antitoxin system HicB family antitoxin -
LV564_RS00665 (LV564_00665) 77161..77406 + 246 WP_275881104.1 plasmid stabilization protein -
LV564_RS00670 (LV564_00670) 77403..77825 + 423 WP_275881105.1 type II toxin-antitoxin system VapC family toxin -
LV564_RS00675 (LV564_00675) 77803..77979 - 177 WP_275881106.1 hypothetical protein -
LV564_RS00680 (LV564_00680) 78187..80247 - 2061 WP_275881107.1 phospholipase D family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..146450 146450


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Ribbon-helix-helix protein, CopG

(12-48)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10785.31 Da        Isoelectric Point: 6.7241

>T273365 WP_275881102.1 NZ_CP118673:c75252-74971 [Komagataeibacter nataicola]
VKYEWTAKAVSDLQTLTADFDHPSAAARVMRRLTAAPDVLIQFPRMGTLLPVFSPREVRRFIVDDYEIRYEVTADALFIT
DIFHTRQDRGTFH

Download         Length: 282 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10488.88 Da        Isoelectric Point: 4.8660

>AT273365 WP_118963924.1 NZ_CP118673:c75536-75249 [Komagataeibacter nataicola]
MSEKLSAGKQVVSVQMPADLVDAMDRYGEAIERPRSWVMREAVASYLAYEAEKDRATRRALADVDAGRTISAEAVKAWAD
SLDQANPLPLPEPKR

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References