Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 22512..23182 | Replicon | plasmid pKNA09 |
| Accession | NZ_CP118672 | ||
| Organism | Komagataeibacter nataicola strain DS12 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LV564_RS00145 | Protein ID | WP_275881073.1 |
| Coordinates | 22760..23182 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LV564_RS00140 | Protein ID | WP_275879433.1 |
| Coordinates | 22512..22763 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV564_RS00120 (LV564_00120) | 18535..20184 | + | 1650 | WP_275881094.1 | 2-oxoglutarate and iron-dependent oxygenase domain-containing protein | - |
| LV564_RS00125 (LV564_00125) | 20529..20693 | - | 165 | WP_166498087.1 | hypothetical protein | - |
| LV564_RS00130 (LV564_00130) | 21003..21488 | - | 486 | WP_275881072.1 | hypothetical protein | - |
| LV564_RS00135 (LV564_00135) | 21887..22309 | + | 423 | WP_034933799.1 | hypothetical protein | - |
| LV564_RS00140 (LV564_00140) | 22512..22763 | + | 252 | WP_275879433.1 | plasmid stabilization protein | Antitoxin |
| LV564_RS00145 (LV564_00145) | 22760..23182 | + | 423 | WP_275881073.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LV564_RS00150 (LV564_00150) | 23388..24119 | - | 732 | WP_275881074.1 | SprT family zinc-dependent metalloprotease | - |
| LV564_RS00155 (LV564_00155) | 24119..27418 | - | 3300 | WP_275881075.1 | HsdR family type I site-specific deoxyribonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..38109 | 38109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15176.44 Da Isoelectric Point: 4.4569
>T273364 WP_275881073.1 NZ_CP118672:22760-23182 [Komagataeibacter nataicola]
MILLDTNVISEPWKPVPEPCVLAWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQTVLQERLEQDVLPLFEGRILSFDL
GASQAYAELMVRARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
MILLDTNVISEPWKPVPEPCVLAWIDAQAIETLFLSAVTVAELRFGIGAMPAGRRQTVLQERLEQDVLPLFEGRILSFDL
GASQAYAELMVRARCEGRAIGKADGYIAATAASRGYAVASRDVSPFEAAGVRVLNPWEDA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|