Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5176771..5177379 | Replicon | chromosome |
Accession | NZ_CP118641 | ||
Organism | Pseudomonas aeruginosa strain P23 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | PUL49_RS24120 | Protein ID | WP_003114156.1 |
Coordinates | 5176771..5177118 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PUL49_RS24125 | Protein ID | WP_003114155.1 |
Coordinates | 5177128..5177379 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUL49_RS24090 (PUL49_24075) | 5172190..5172402 | + | 213 | WP_003098360.1 | cysteine-rich CWC family protein | - |
PUL49_RS24095 (PUL49_24080) | 5172402..5173094 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
PUL49_RS24100 (PUL49_24085) | 5173230..5174273 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PUL49_RS24105 (PUL49_24090) | 5174353..5175090 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PUL49_RS24110 (PUL49_24095) | 5175542..5176444 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PUL49_RS24120 (PUL49_24105) | 5176771..5177118 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUL49_RS24125 (PUL49_24110) | 5177128..5177379 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUL49_RS24130 (PUL49_24115) | 5177593..5178576 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
PUL49_RS24135 (PUL49_24120) | 5178576..5179868 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
PUL49_RS24140 (PUL49_24125) | 5180098..5181372 | - | 1275 | WP_281004908.1 | zonular occludens toxin family protein | - |
PUL49_RS24145 (PUL49_24130) | 5181376..5181732 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5176771..5201090 | 24319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T273362 WP_003114156.1 NZ_CP118641:c5177118-5176771 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |