Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4926133..4926741 | Replicon | chromosome |
Accession | NZ_CP118638 | ||
Organism | Pseudomonas aeruginosa strain P9 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | PUN20_RS23080 | Protein ID | WP_003123043.1 |
Coordinates | 4926133..4926480 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PUN20_RS23085 | Protein ID | WP_003114155.1 |
Coordinates | 4926490..4926741 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUN20_RS23050 (PUN20_23035) | 4921552..4921764 | + | 213 | WP_023082749.1 | cysteine-rich CWC family protein | - |
PUN20_RS23055 (PUN20_23040) | 4921764..4922456 | + | 693 | WP_016851968.1 | 16S rRNA pseudouridine(516) synthase | - |
PUN20_RS23060 (PUN20_23045) | 4922592..4923635 | + | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
PUN20_RS23065 (PUN20_23050) | 4923715..4924452 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PUN20_RS23070 (PUN20_23055) | 4924904..4925806 | + | 903 | WP_014603238.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PUN20_RS23080 (PUN20_23065) | 4926133..4926480 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUN20_RS23085 (PUN20_23070) | 4926490..4926741 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUN20_RS23090 (PUN20_23075) | 4926954..4927936 | - | 983 | Protein_4568 | tyrosine-type recombinase/integrase | - |
PUN20_RS23095 (PUN20_23080) | 4927936..4929228 | - | 1293 | WP_023090049.1 | hypothetical protein | - |
PUN20_RS23100 (PUN20_23085) | 4929866..4930255 | - | 390 | WP_034053350.1 | hypothetical protein | - |
PUN20_RS23105 (PUN20_23090) | 4930248..4930463 | - | 216 | WP_023090052.1 | hypothetical protein | - |
PUN20_RS23110 (PUN20_23095) | 4930486..4930701 | - | 216 | WP_023090053.1 | hypothetical protein | - |
PUN20_RS23115 (PUN20_23100) | 4930853..4931098 | + | 246 | WP_228380994.1 | DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4925983..4935958 | 9975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T273355 WP_003123043.1 NZ_CP118638:c4926480-4926133 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |