Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4662574..4663190 Replicon chromosome
Accession NZ_CP118633
Organism Salmonella enterica subsp. enterica serovar Anatum strain 2089b

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PWO88_RS22705 Protein ID WP_023243564.1
Coordinates 4662574..4662948 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PWO88_RS22710 Protein ID WP_001523745.1
Coordinates 4662948..4663190 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWO88_RS22690 (4660076) 4660076..4660978 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
PWO88_RS22695 (4660975) 4660975..4661610 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PWO88_RS22700 (4661607) 4661607..4662536 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PWO88_RS22705 (4662574) 4662574..4662948 - 375 WP_023243564.1 type II toxin-antitoxin system VapC family toxin Toxin
PWO88_RS22710 (4662948) 4662948..4663190 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PWO88_RS22715 (4663395) 4663395..4664324 + 930 WP_001162860.1 alpha/beta hydrolase -
PWO88_RS22720 (4664410) 4664410..4664721 + 312 WP_000558166.1 type II toxin-antitoxin system HigB family toxin -
PWO88_RS22725 (4664718) 4664718..4665164 + 447 WP_031609809.1 type II toxin-antitoxin system HigA family antitoxin -
PWO88_RS22730 (4665179) 4665179..4666120 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PWO88_RS22735 (4666165) 4666165..4666602 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PWO88_RS22740 (4666599) 4666599..4667471 - 873 WP_000921423.1 virulence factor BrkB family protein -
PWO88_RS22745 (4667465) 4667465..4668064 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13880.13 Da        Isoelectric Point: 7.3567

>T273348 WP_023243564.1 NZ_CP118633:c4662948-4662574 [Salmonella enterica subsp. enterica serovar Anatum]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMAGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT273348 WP_001523745.1 NZ_CP118633:c4663190-4662948 [Salmonella enterica subsp. enterica serovar Anatum]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References