Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4350147..4350928 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I5SY00 |
Locus tag | PWO88_RS21320 | Protein ID | WP_000626104.1 |
Coordinates | 4350147..4350638 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | PWO88_RS21325 | Protein ID | WP_001110452.1 |
Coordinates | 4350635..4350928 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS21295 (4345288) | 4345288..4347725 | - | 2438 | Protein_4173 | F4 (K88) fimbrial usher FaeD | - |
PWO88_RS21300 (4347735) | 4347735..4348274 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PWO88_RS21305 (4348309) | 4348309..4348599 | - | 291 | WP_000773468.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PWO88_RS21310 (4349182) | 4349182..4349409 | + | 228 | WP_001519955.1 | hypothetical protein | - |
PWO88_RS21315 (4349684) | 4349684..4349932 | - | 249 | Protein_4177 | IS481 family transposase | - |
PWO88_RS21320 (4350147) | 4350147..4350638 | - | 492 | WP_000626104.1 | GNAT family N-acetyltransferase | Toxin |
PWO88_RS21325 (4350635) | 4350635..4350928 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
PWO88_RS21330 (4351245) | 4351245..4351466 | + | 222 | WP_021001044.1 | hypothetical protein | - |
PWO88_RS21335 (4351732) | 4351732..4352607 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
PWO88_RS21340 (4352604) | 4352604..4352891 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PWO88_RS21345 (4352914) | 4352914..4353129 | + | 216 | WP_001595136.1 | hypothetical protein | - |
PWO88_RS21350 (4353137) | 4353137..4353406 | + | 270 | WP_010989096.1 | hypothetical protein | - |
PWO88_RS21355 (4353700) | 4353700..4354605 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeE / faeD / faeD / faeC | 4344480..4353406 | 8926 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17631.42 Da Isoelectric Point: 7.7297
>T273347 WP_000626104.1 NZ_CP118633:c4350638-4350147 [Salmonella enterica subsp. enterica serovar Anatum]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT273347 WP_001110452.1 NZ_CP118633:c4350928-4350635 [Salmonella enterica subsp. enterica serovar Anatum]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5SY00 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |