Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4226347..4226863 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5U7R3Q6 |
Locus tag | PWO88_RS20660 | Protein ID | WP_023243277.1 |
Coordinates | 4226347..4226631 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PWO88_RS20665 | Protein ID | WP_000212724.1 |
Coordinates | 4226621..4226863 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS20645 (4221463) | 4221463..4223115 | + | 1653 | WP_023243275.1 | alpha,alpha-phosphotrehalase | - |
PWO88_RS20650 (4223524) | 4223524..4225662 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PWO88_RS20655 (4225879) | 4225879..4226343 | + | 465 | WP_023243276.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PWO88_RS20660 (4226347) | 4226347..4226631 | - | 285 | WP_023243277.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWO88_RS20665 (4226621) | 4226621..4226863 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PWO88_RS20670 (4226941) | 4226941..4228854 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
PWO88_RS20675 (4228871) | 4228871..4229611 | - | 741 | WP_023243278.1 | KDGP aldolase family protein | - |
PWO88_RS20680 (4229608) | 4229608..4230726 | - | 1119 | WP_023243279.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PWO88_RS20685 (4230710) | 4230710..4231843 | - | 1134 | WP_023243280.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10801.62 Da Isoelectric Point: 9.6730
>T273346 WP_023243277.1 NZ_CP118633:c4226631-4226347 [Salmonella enterica subsp. enterica serovar Anatum]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5U7R3Q6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |