Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4139593..4140169 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | PWO88_RS20250 | Protein ID | WP_001131963.1 |
Coordinates | 4139882..4140169 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
Locus tag | PWO88_RS20245 | Protein ID | WP_000063143.1 |
Coordinates | 4139593..4139895 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS20230 (4136103) | 4136103..4138253 | + | 2151 | WP_023244016.1 | pyruvate/proton symporter BtsT | - |
PWO88_RS20235 (4138348) | 4138348..4138551 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
PWO88_RS20240 (4138562) | 4138562..4139518 | + | 957 | WP_000612222.1 | GTPase | - |
PWO88_RS20245 (4139593) | 4139593..4139895 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
PWO88_RS20250 (4139882) | 4139882..4140169 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
PWO88_RS20255 (4140438) | 4140438..4141352 | - | 915 | WP_023244015.1 | restriction endonuclease | - |
PWO88_RS20260 (4141550) | 4141550..4145059 | + | 3510 | WP_023244014.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T273345 WP_001131963.1 NZ_CP118633:c4140169-4139882 [Salmonella enterica subsp. enterica serovar Anatum]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT273345 WP_000063143.1 NZ_CP118633:c4139895-4139593 [Salmonella enterica subsp. enterica serovar Anatum]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|