Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3537512..3538132 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PWO88_RS17480 | Protein ID | WP_001280991.1 |
Coordinates | 3537914..3538132 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PWO88_RS17475 | Protein ID | WP_000344807.1 |
Coordinates | 3537512..3537886 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS17465 (3532651) | 3532651..3533844 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PWO88_RS17470 (3533867) | 3533867..3537016 | + | 3150 | WP_080155288.1 | efflux RND transporter permease AcrB | - |
PWO88_RS17475 (3537512) | 3537512..3537886 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PWO88_RS17480 (3537914) | 3537914..3538132 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PWO88_RS17485 (3538311) | 3538311..3538862 | + | 552 | WP_080155289.1 | maltose O-acetyltransferase | - |
PWO88_RS17490 (3538978) | 3538978..3539448 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PWO88_RS17495 (3539504) | 3539504..3539644 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PWO88_RS17500 (3539650) | 3539650..3539910 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PWO88_RS17505 (3540135) | 3540135..3541685 | + | 1551 | WP_023243162.1 | EAL domain-containing protein | - |
PWO88_RS17515 (3541916) | 3541916..3542305 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PWO88_RS17520 (3542338) | 3542338..3542907 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T273342 WP_001280991.1 NZ_CP118633:3537914-3538132 [Salmonella enterica subsp. enterica serovar Anatum]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT273342 WP_000344807.1 NZ_CP118633:3537512-3537886 [Salmonella enterica subsp. enterica serovar Anatum]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|