Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2470373..2470895 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5U0LRG3 |
Locus tag | PWO88_RS12125 | Protein ID | WP_023243932.1 |
Coordinates | 2470611..2470895 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PWO88_RS12120 | Protein ID | WP_000885424.1 |
Coordinates | 2470373..2470621 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS12090 (2466487) | 2466487..2467043 | + | 557 | Protein_2368 | hypothetical protein | - |
PWO88_RS12095 (2467321) | 2467321..2467602 | + | 282 | WP_001580000.1 | hypothetical protein | - |
PWO88_RS12100 (2467973) | 2467973..2468569 | + | 597 | Protein_2370 | helix-turn-helix domain-containing protein | - |
PWO88_RS12105 (2468625) | 2468625..2469533 | - | 909 | WP_077909464.1 | hypothetical protein | - |
PWO88_RS12110 (2469684) | 2469684..2470016 | - | 333 | WP_023244369.1 | DUF1493 family protein | - |
PWO88_RS12115 (2470006) | 2470006..2470221 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PWO88_RS12120 (2470373) | 2470373..2470621 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PWO88_RS12125 (2470611) | 2470611..2470895 | + | 285 | WP_023243932.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWO88_RS12130 (2471066) | 2471066..2471451 | + | 386 | Protein_2376 | RidA family protein | - |
PWO88_RS12135 (2471503) | 2471503..2472582 | - | 1080 | WP_023244370.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PWO88_RS12140 (2472775) | 2472775..2473263 | - | 489 | WP_023243930.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PWO88_RS12145 (2473308) | 2473308..2474816 | + | 1509 | WP_023243929.1 | FAD-dependent oxidoreductase | - |
PWO88_RS12150 (2474806) | 2474806..2475782 | + | 977 | Protein_2380 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2467321..2477408 | 10087 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11057.82 Da Isoelectric Point: 10.6500
>T273341 WP_023243932.1 NZ_CP118633:2470611-2470895 [Salmonella enterica subsp. enterica serovar Anatum]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAIYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAIYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5U0LRG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |