Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2005552..2006142 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A5Z3IR43 |
Locus tag | PWO88_RS09730 | Protein ID | WP_023243734.1 |
Coordinates | 2005810..2006142 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A618JW87 |
Locus tag | PWO88_RS09725 | Protein ID | WP_023243733.1 |
Coordinates | 2005552..2005809 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS09710 (2002214) | 2002214..2004169 | - | 1956 | WP_024149369.1 | hypothetical protein | - |
PWO88_RS09715 (2004528) | 2004528..2005001 | + | 474 | WP_194548145.1 | hypothetical protein | - |
PWO88_RS09720 (2004998) | 2004998..2005204 | + | 207 | WP_023243732.1 | helix-turn-helix transcriptional regulator | - |
PWO88_RS09725 (2005552) | 2005552..2005809 | + | 258 | WP_023243733.1 | MazE family transcriptional regulator | Antitoxin |
PWO88_RS09730 (2005810) | 2005810..2006142 | + | 333 | WP_023243734.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PWO88_RS09735 (2006977) | 2006977..2007861 | + | 885 | WP_031609821.1 | integrase domain-containing protein | - |
PWO88_RS09740 (2008806) | 2008806..2010068 | - | 1263 | WP_023244267.1 | integrase arm-type DNA-binding domain-containing protein | - |
PWO88_RS09750 (2010727) | 2010727..2011032 | - | 306 | Protein_1909 | Arm DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11779.65 Da Isoelectric Point: 10.5834
>T273336 WP_023243734.1 NZ_CP118633:2005810-2006142 [Salmonella enterica subsp. enterica serovar Anatum]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVIPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVIPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3IR43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A618JW87 |