Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 864675..865300 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PWO88_RS04175 | Protein ID | WP_000911337.1 |
Coordinates | 864902..865300 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PWO88_RS04170 | Protein ID | WP_000557549.1 |
Coordinates | 864675..864902 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS04140 (859739) | 859739..860837 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
PWO88_RS04145 (860847) | 860847..862364 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PWO88_RS04150 (862440) | 862440..862985 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PWO88_RS04155 (863250) | 863250..864008 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PWO88_RS04165 (864254) | 864254..864466 | - | 213 | WP_024149321.1 | endonuclease | - |
PWO88_RS04170 (864675) | 864675..864902 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PWO88_RS04175 (864902) | 864902..865300 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PWO88_RS04180 (866106) | 866106..866642 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PWO88_RS04185 (866689) | 866689..867321 | + | 633 | WP_000835264.1 | YfdX family protein | - |
PWO88_RS04190 (868040) | 868040..868621 | + | 582 | WP_023243212.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 864254..874478 | 10224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T273334 WP_000911337.1 NZ_CP118633:864902-865300 [Salmonella enterica subsp. enterica serovar Anatum]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|