Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 854915..855575 | Replicon | chromosome |
Accession | NZ_CP118633 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | PWO88_RS04115 | Protein ID | WP_000244756.1 |
Coordinates | 855162..855575 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PWO88_RS04110 | Protein ID | WP_000351186.1 |
Coordinates | 854915..855181 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWO88_RS04090 (850844) | 850844..852277 | - | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
PWO88_RS04095 (852435) | 852435..852746 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PWO88_RS04100 (852910) | 852910..853569 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PWO88_RS04105 (853685) | 853685..854665 | - | 981 | WP_000874178.1 | tRNA-modifying protein YgfZ | - |
PWO88_RS04110 (854915) | 854915..855181 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PWO88_RS04115 (855162) | 855162..855575 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
PWO88_RS04120 (855628) | 855628..856149 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PWO88_RS04125 (856262) | 856262..857158 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PWO88_RS04130 (857182) | 857182..857895 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PWO88_RS04135 (857901) | 857901..859634 | + | 1734 | WP_000813389.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T273333 WP_000244756.1 NZ_CP118633:855162-855575 [Salmonella enterica subsp. enterica serovar Anatum]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |