Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 348211..348797 Replicon chromosome
Accession NZ_CP118633
Organism Salmonella enterica subsp. enterica serovar Anatum strain 2089b

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PWO88_RS01590 Protein ID WP_000174963.1
Coordinates 348429..348797 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag PWO88_RS01585 Protein ID WP_001522145.1
Coordinates 348211..348432 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWO88_RS01560 (343232) 343232..344341 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PWO88_RS01565 (344401) 344401..345327 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PWO88_RS01570 (345324) 345324..346601 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PWO88_RS01575 (346598) 346598..347365 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PWO88_RS01580 (347367) 347367..348080 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PWO88_RS01585 (348211) 348211..348432 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWO88_RS01590 (348429) 348429..348797 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PWO88_RS01595 (349056) 349056..350372 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PWO88_RS01600 (350477) 350477..351364 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PWO88_RS01605 (351361) 351361..352206 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PWO88_RS01610 (352208) 352208..353278 + 1071 WP_023243433.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 345324..354015 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T273332 WP_000174963.1 NZ_CP118633:348429-348797 [Salmonella enterica subsp. enterica serovar Anatum]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT273332 WP_001522145.1 NZ_CP118633:348211-348432 [Salmonella enterica subsp. enterica serovar Anatum]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure

References