Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 621962..622539 | Replicon | plasmid pVWJL.P1 |
| Accession | NZ_CP118630 | ||
| Organism | Pantoea dispersa strain VWJL.P1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PWF83_RS22335 | Protein ID | WP_058770345.1 |
| Coordinates | 622207..622539 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A8E1V6C0 |
| Locus tag | PWF83_RS22330 | Protein ID | WP_058770344.1 |
| Coordinates | 621962..622207 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWF83_RS22310 (PWF83_22320) | 617324..618277 | + | 954 | WP_127835008.1 | carbohydrate kinase family protein | - |
| PWF83_RS22315 (PWF83_22325) | 618281..619363 | + | 1083 | WP_275029538.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| PWF83_RS22320 (PWF83_22330) | 619483..620892 | - | 1410 | WP_058781049.1 | MFS transporter | - |
| PWF83_RS22325 (PWF83_22335) | 621008..621862 | + | 855 | WP_058770343.1 | helix-turn-helix transcriptional regulator | - |
| PWF83_RS22330 (PWF83_22340) | 621962..622207 | + | 246 | WP_058770344.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PWF83_RS22335 (PWF83_22345) | 622207..622539 | + | 333 | WP_058770345.1 | endoribonuclease MazF | Toxin |
| PWF83_RS22340 (PWF83_22350) | 622645..622818 | + | 174 | WP_021508895.1 | hypothetical protein | - |
| PWF83_RS22345 (PWF83_22355) | 622848..623195 | + | 348 | WP_021508894.1 | hypothetical protein | - |
| PWF83_RS22350 (PWF83_22360) | 623235..624428 | - | 1194 | WP_058781047.1 | zinc-dependent alcohol dehydrogenase | - |
| PWF83_RS22355 (PWF83_22365) | 624692..625399 | + | 708 | WP_021508892.1 | phage antirepressor KilAC domain-containing protein | - |
| PWF83_RS22360 (PWF83_22370) | 625434..625649 | - | 216 | WP_021508891.1 | hypothetical protein | - |
| PWF83_RS22365 (PWF83_22375) | 625791..626972 | - | 1182 | WP_125310195.1 | FAD-binding oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN | 1..708540 | 708540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12009.84 Da Isoelectric Point: 7.8855
>T273329 WP_058770345.1 NZ_CP118630:622207-622539 [Pantoea dispersa]
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLTGSRDSVALADQVTSI
DWRARKVVKKSHVTAEELSEIRAKAKALIG
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLTGSRDSVALADQVTSI
DWRARKVVKKSHVTAEELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|