Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 524320..525022 | Replicon | plasmid pVWJL.P1 |
Accession | NZ_CP118630 | ||
Organism | Pantoea dispersa strain VWJL.P1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PWF83_RS21820 | Protein ID | WP_264444068.1 |
Coordinates | 524639..525022 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A246NDH1 |
Locus tag | PWF83_RS21815 | Protein ID | WP_058770279.1 |
Coordinates | 524320..524646 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF83_RS21795 (PWF83_21805) | 519947..520981 | - | 1035 | WP_275029419.1 | aldehyde reductase | - |
PWF83_RS21800 (PWF83_21810) | 521090..522022 | + | 933 | WP_275029421.1 | AraC family transcriptional regulator | - |
PWF83_RS21805 (PWF83_21815) | 522051..523085 | - | 1035 | WP_275029423.1 | L-glyceraldehyde 3-phosphate reductase | - |
PWF83_RS21810 (PWF83_21820) | 523255..524154 | + | 900 | WP_275029425.1 | LysR family transcriptional regulator | - |
PWF83_RS21815 (PWF83_21825) | 524320..524646 | - | 327 | WP_058770279.1 | helix-turn-helix domain-containing protein | Antitoxin |
PWF83_RS21820 (PWF83_21830) | 524639..525022 | - | 384 | WP_264444068.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWF83_RS21825 (PWF83_21835) | 525328..525618 | + | 291 | WP_058770280.1 | hypothetical protein | - |
PWF83_RS21830 (PWF83_21840) | 525643..527070 | - | 1428 | WP_275029429.1 | trehalose-6-phosphate synthase | - |
PWF83_RS21835 (PWF83_21845) | 527242..528105 | - | 864 | WP_275029432.1 | substrate-binding domain-containing protein | - |
PWF83_RS21840 (PWF83_21850) | 528340..529035 | + | 696 | WP_058775966.1 | hypothetical protein | - |
PWF83_RS21845 (PWF83_21855) | 529134..529664 | + | 531 | WP_021508986.1 | outer membrane lipoprotein Blc | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..708540 | 708540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14083.43 Da Isoelectric Point: 10.2744
>T273327 WP_264444068.1 NZ_CP118630:c525022-524639 [Pantoea dispersa]
MAIYVLKPFDRNFKGDMIADIKLCLAARELIAGQYEASLGGGVYKKRIPLGAGKSGGARAIVAFKSQKHLFFVNGYAKST
TKSGIREIKEDEINFYRQVASQLFAMTTEQERAAIKARKMREVICDG
MAIYVLKPFDRNFKGDMIADIKLCLAARELIAGQYEASLGGGVYKKRIPLGAGKSGGARAIVAFKSQKHLFFVNGYAKST
TKSGIREIKEDEINFYRQVASQLFAMTTEQERAAIKARKMREVICDG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|