Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3899205..3899787 | Replicon | chromosome |
Accession | NZ_CP118629 | ||
Organism | Pantoea dispersa strain VWJL.P1 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | PWF83_RS18150 | Protein ID | WP_058771045.1 |
Coordinates | 3899488..3899787 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A8E1S1N8 |
Locus tag | PWF83_RS18145 | Protein ID | WP_058775497.1 |
Coordinates | 3899205..3899507 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF83_RS18140 (PWF83_18150) | 3895819..3899199 | + | 3381 | WP_275026959.1 | cellulose synthase complex outer membrane protein BcsC | - |
PWF83_RS18145 (PWF83_18155) | 3899205..3899507 | - | 303 | WP_058775497.1 | BrnA antitoxin family protein | Antitoxin |
PWF83_RS18150 (PWF83_18160) | 3899488..3899787 | - | 300 | WP_058771045.1 | BrnT family toxin | Toxin |
PWF83_RS18155 (PWF83_18165) | 3900010..3901014 | - | 1005 | WP_031279620.1 | glycosyl hydrolase family 8 | - |
PWF83_RS18160 (PWF83_18170) | 3901024..3901470 | - | 447 | WP_275026965.1 | cellulose biosynthesis protein BcsD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11919.36 Da Isoelectric Point: 6.9910
>T273324 WP_058771045.1 NZ_CP118629:c3899787-3899488 [Pantoea dispersa]
MQTEPEFEWDTTKAETNFRKHGIRFEVAARVFEDPFHLSVQDRYENGEYRWQTIGNVMGHVVILVAHTVRFETDVERIRI
ISARHATRIERRRYEQSQV
MQTEPEFEWDTTKAETNFRKHGIRFEVAARVFEDPFHLSVQDRYENGEYRWQTIGNVMGHVVILVAHTVRFETDVERIRI
ISARHATRIERRRYEQSQV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|