Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 3665311..3666215 | Replicon | chromosome |
Accession | NZ_CP118629 | ||
Organism | Pantoea dispersa strain VWJL.P1 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A8E1V7L7 |
Locus tag | PWF83_RS17125 | Protein ID | WP_058774932.1 |
Coordinates | 3665751..3666215 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A246NMT1 |
Locus tag | PWF83_RS17120 | Protein ID | WP_058757556.1 |
Coordinates | 3665311..3665754 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF83_RS17100 (PWF83_17110) | 3661423..3661818 | + | 396 | WP_031279757.1 | transposase | - |
PWF83_RS17105 (PWF83_17115) | 3662727..3663680 | - | 954 | WP_275026703.1 | DMT family transporter | - |
PWF83_RS17110 (PWF83_17120) | 3663753..3664583 | - | 831 | WP_132465743.1 | AraC family transcriptional regulator | - |
PWF83_RS17115 (PWF83_17125) | 3664710..3665237 | + | 528 | WP_275026707.1 | isochorismatase family protein | - |
PWF83_RS17120 (PWF83_17130) | 3665311..3665754 | + | 444 | WP_058757556.1 | DUF2384 domain-containing protein | Antitoxin |
PWF83_RS17125 (PWF83_17135) | 3665751..3666215 | + | 465 | WP_058774932.1 | RES domain-containing protein | Toxin |
PWF83_RS17130 (PWF83_17140) | 3666267..3666809 | - | 543 | WP_021507842.1 | single-stranded DNA-binding protein SSB1 | - |
PWF83_RS17135 (PWF83_17145) | 3667031..3669859 | + | 2829 | WP_021507843.1 | excinuclease ABC subunit UvrA | - |
PWF83_RS17140 (PWF83_17150) | 3670135..3671199 | + | 1065 | WP_275026712.1 | NAD(P)-dependent alcohol dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17117.59 Da Isoelectric Point: 5.1259
>T273323 WP_058774932.1 NZ_CP118629:3665751-3666215 [Pantoea dispersa]
VIFYRLTKSQYAAEAWSGYGAKQYGGRWNHKGYPTVYVATSVSLAALEVLVHIGRESVLDEYTLFSIDIPDAEVAYLAEA
FLPPDWRHDPAPLSTMDLGTGWLQSAEGAALMLPSTIIPMENNAILNPLHPAFSDYLPGVKALPFMFDRRLIRT
VIFYRLTKSQYAAEAWSGYGAKQYGGRWNHKGYPTVYVATSVSLAALEVLVHIGRESVLDEYTLFSIDIPDAEVAYLAEA
FLPPDWRHDPAPLSTMDLGTGWLQSAEGAALMLPSTIIPMENNAILNPLHPAFSDYLPGVKALPFMFDRRLIRT
Download Length: 465 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16114.59 Da Isoelectric Point: 9.9132
>AT273323 WP_058757556.1 NZ_CP118629:3665311-3665754 [Pantoea dispersa]
MRAYIPQPGANDNALWRVAGLPPRGIELTRMLEAGLPVAVIDDIRHWSAMTRAEIMKVTGINERNIARRKSTGKSLSPDE
SERVARFVRVMDAAVQLFAGNKEEATQWLSRPVKGLGNVAPITLLTTESGALDVLDLIGRLEHGVFS
MRAYIPQPGANDNALWRVAGLPPRGIELTRMLEAGLPVAVIDDIRHWSAMTRAEIMKVTGINERNIARRKSTGKSLSPDE
SERVARFVRVMDAAVQLFAGNKEEATQWLSRPVKGLGNVAPITLLTTESGALDVLDLIGRLEHGVFS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|