Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3023907..3024527 Replicon chromosome
Accession NZ_CP118629
Organism Pantoea dispersa strain VWJL.P1

Toxin (Protein)


Gene name Hha Uniprot ID A0A246NIG6
Locus tag PWF83_RS14220 Protein ID WP_021507203.1
Coordinates 3024309..3024527 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A246NI99
Locus tag PWF83_RS14215 Protein ID WP_021313568.1
Coordinates 3023907..3024284 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWF83_RS14185 (PWF83_14195) 3020231..3020488 + 258 WP_021507208.1 type B 50S ribosomal protein L31 -
PWF83_RS14190 (PWF83_14200) 3020504..3020644 + 141 WP_010616859.1 type B 50S ribosomal protein L36 -
PWF83_RS14195 (PWF83_14205) 3020689..3021567 - 879 WP_058769397.1 metal ABC transporter substrate-binding protein -
PWF83_RS14200 (PWF83_14210) 3021589..3022428 - 840 WP_058775239.1 metal ABC transporter permease -
PWF83_RS14205 (PWF83_14215) 3022425..3023081 - 657 WP_021507205.1 ABC transporter ATP-binding protein -
PWF83_RS14210 (PWF83_14220) 3023408..3023761 + 354 WP_275025951.1 hypothetical protein -
PWF83_RS14215 (PWF83_14225) 3023907..3024284 + 378 WP_021313568.1 Hha toxicity modulator TomB Antitoxin
PWF83_RS14220 (PWF83_14230) 3024309..3024527 + 219 WP_021507203.1 HHA domain-containing protein Toxin
PWF83_RS14230 (PWF83_14240) 3024929..3025240 + 312 WP_021507202.1 MGMT family protein -
PWF83_RS14235 (PWF83_14245) 3025408..3025965 - 558 WP_021507201.1 YbaY family lipoprotein -
PWF83_RS14240 (PWF83_14250) 3025981..3026172 + 192 WP_125309056.1 hypothetical protein -
PWF83_RS14245 (PWF83_14255) 3026169..3027032 + 864 WP_088516247.1 acyl-CoA thioesterase II -
PWF83_RS14250 (PWF83_14260) 3027105..3028394 - 1290 WP_021507199.1 ammonium transporter AmtB -
PWF83_RS14255 (PWF83_14265) 3028428..3028766 - 339 WP_007886947.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8538.87 Da        Isoelectric Point: 8.8662

>T273321 WP_021507203.1 NZ_CP118629:3024309-3024527 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14665.34 Da        Isoelectric Point: 4.4796

>AT273321 WP_021313568.1 NZ_CP118629:3023907-3024284 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246NIG6

Antitoxin

Source ID Structure
AlphaFold DB A0A246NI99

References