Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2426909..2427523 | Replicon | chromosome |
| Accession | NZ_CP118629 | ||
| Organism | Pantoea dispersa strain VWJL.P1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A246NCD7 |
| Locus tag | PWF83_RS11295 | Protein ID | WP_058757609.1 |
| Coordinates | 2426909..2427091 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PWF83_RS11300 | Protein ID | WP_022548759.1 |
| Coordinates | 2427131..2427523 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWF83_RS11245 (PWF83_11255) | 2422054..2422716 | + | 663 | WP_021506360.1 | MBL fold metallo-hydrolase | - |
| PWF83_RS11250 (PWF83_11260) | 2422717..2423130 | - | 414 | WP_058757613.1 | GNAT family N-acetyltransferase | - |
| PWF83_RS11255 (PWF83_11265) | 2423152..2423535 | - | 384 | WP_058757612.1 | hypothetical protein | - |
| PWF83_RS11260 (PWF83_11270) | 2423753..2424109 | + | 357 | WP_010617204.1 | DUF4186 domain-containing protein | - |
| PWF83_RS11265 (PWF83_11275) | 2424128..2424307 | - | 180 | WP_031279245.1 | hypothetical protein | - |
| PWF83_RS11270 (PWF83_11280) | 2424511..2424840 | + | 330 | WP_021506365.1 | hypothetical protein | - |
| PWF83_RS11275 (PWF83_11285) | 2424902..2425450 | + | 549 | WP_238560976.1 | hypothetical protein | - |
| PWF83_RS11280 (PWF83_11290) | 2425475..2425681 | - | 207 | WP_021506367.1 | DUF2767 family protein | - |
| PWF83_RS11285 (PWF83_11295) | 2425862..2426110 | + | 249 | WP_021506368.1 | DUF883 family protein | - |
| PWF83_RS11290 (PWF83_11300) | 2426443..2426640 | - | 198 | WP_021506369.1 | DUF6404 family protein | - |
| PWF83_RS11295 (PWF83_11305) | 2426909..2427091 | + | 183 | WP_058757609.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PWF83_RS11300 (PWF83_11310) | 2427131..2427523 | + | 393 | WP_022548759.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PWF83_RS11305 (PWF83_11315) | 2427608..2428864 | + | 1257 | WP_275025275.1 | mechanosensitive ion channel | - |
| PWF83_RS11310 (PWF83_11320) | 2428993..2430243 | - | 1251 | WP_010617214.1 | NADP-dependent isocitrate dehydrogenase | - |
| PWF83_RS11315 (PWF83_11325) | 2430345..2431013 | + | 669 | WP_150058306.1 | 23S rRNA pseudouridine(2457) synthase RluE | - |
| PWF83_RS11320 (PWF83_11330) | 2431058..2431531 | + | 474 | WP_275025280.1 | NUDIX hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6958.19 Da Isoelectric Point: 10.9062
>T273320 WP_058757609.1 NZ_CP118629:2426909-2427091 [Pantoea dispersa]
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14554.49 Da Isoelectric Point: 4.8732
>AT273320 WP_022548759.1 NZ_CP118629:2427131-2427523 [Pantoea dispersa]
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|