Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1095904..1096588 | Replicon | chromosome |
| Accession | NZ_CP118629 | ||
| Organism | Pantoea dispersa strain VWJL.P1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PWF83_RS04915 | Protein ID | WP_130942918.1 |
| Coordinates | 1095904..1096233 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PWF83_RS04920 | Protein ID | WP_015386412.1 |
| Coordinates | 1096265..1096588 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWF83_RS04895 (PWF83_04900) | 1091880..1092112 | + | 233 | Protein_940 | DinI-like family protein | - |
| PWF83_RS04900 (PWF83_04905) | 1092437..1093600 | + | 1164 | WP_275028215.1 | AAA family ATPase | - |
| PWF83_RS04905 (PWF83_04910) | 1093604..1094641 | + | 1038 | WP_275028216.1 | DUF4435 domain-containing protein | - |
| PWF83_RS04910 (PWF83_04915) | 1094679..1095606 | - | 928 | Protein_943 | phage portal protein | - |
| PWF83_RS04915 (PWF83_04920) | 1095904..1096233 | - | 330 | WP_130942918.1 | TA system toxin CbtA family protein | Toxin |
| PWF83_RS04920 (PWF83_04925) | 1096265..1096588 | - | 324 | WP_015386412.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PWF83_RS04925 (PWF83_04930) | 1096610..1096831 | - | 222 | WP_219940149.1 | DUF987 family protein | - |
| PWF83_RS04930 (PWF83_04935) | 1096840..1097313 | - | 474 | WP_130942920.1 | DNA repair protein RadC | - |
| PWF83_RS04935 (PWF83_04940) | 1097346..1098164 | - | 819 | WP_275028217.1 | DUF932 domain-containing protein | - |
| PWF83_RS04940 (PWF83_04945) | 1098783..1101302 | + | 2520 | WP_275028218.1 | antiviral RADAR system adenosine triphosphatase RdrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1089159..1117922 | 28763 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12465.12 Da Isoelectric Point: 4.8087
>T273317 WP_130942918.1 NZ_CP118629:c1096233-1095904 [Pantoea dispersa]
MHISSVPATVPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHDDTAIEEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVE
MHISSVPATVPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHDDTAIEEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVE
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|