Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 1743575..1744055 | Replicon | chromosome |
Accession | NZ_CP118614 | ||
Organism | Nocardiopsis sp. DZFXJ 01 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | PV789_RS07765 | Protein ID | WP_274976787.1 |
Coordinates | 1743783..1744055 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | PV789_RS07760 | Protein ID | WP_274976786.1 |
Coordinates | 1743575..1743799 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PV789_RS07735 (PV789_07735) | 1739010..1739807 | + | 798 | WP_274976781.1 | TIM barrel protein | - |
PV789_RS07740 (PV789_07740) | 1739890..1740780 | + | 891 | WP_274976782.1 | 2-hydroxy-3-oxopropionate reductase | - |
PV789_RS07745 (PV789_07745) | 1740991..1742706 | + | 1716 | WP_274976783.1 | glyoxylate carboligase | - |
PV789_RS07750 (PV789_07750) | 1742934..1743284 | + | 351 | WP_274976784.1 | hypothetical protein | - |
PV789_RS07755 (PV789_07755) | 1743337..1743501 | - | 165 | WP_274976785.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PV789_RS07760 (PV789_07760) | 1743575..1743799 | + | 225 | WP_274976786.1 | TraY domain-containing protein | Antitoxin |
PV789_RS07765 (PV789_07765) | 1743783..1744055 | + | 273 | WP_274976787.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PV789_RS07770 (PV789_07770) | 1744207..1745268 | + | 1062 | WP_274976788.1 | alkene reductase | - |
PV789_RS07775 (PV789_07775) | 1745711..1747411 | + | 1701 | WP_274976789.1 | 2-isopropylmalate synthase | - |
PV789_RS07780 (PV789_07780) | 1747478..1748188 | - | 711 | WP_274976790.1 | DUF2625 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10635.32 Da Isoelectric Point: 10.0371
>T273312 WP_274976787.1 NZ_CP118614:1743783-1744055 [Nocardiopsis sp. DZFXJ 01]
MTWKVELHDDARRDLRKLDPQVVRRILRFLKDRVEGADDPRCLGEALKGSRLGDLWRYRVGDYRVVVDIRDGLLVVLVVH
IAHRSQVYRD
MTWKVELHDDARRDLRKLDPQVVRRILRFLKDRVEGADDPRCLGEALKGSRLGDLWRYRVGDYRVVVDIRDGLLVVLVVH
IAHRSQVYRD
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|