Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 600924..601563 | Replicon | chromosome |
Accession | NZ_CP118614 | ||
Organism | Nocardiopsis sp. DZFXJ 01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PV789_RS02820 | Protein ID | WP_248773323.1 |
Coordinates | 600924..601343 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PV789_RS02825 | Protein ID | WP_212641706.1 |
Coordinates | 601348..601563 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PV789_RS02805 (PV789_02805) | 596458..597327 | + | 870 | WP_274976031.1 | pantoate--beta-alanine ligase | - |
PV789_RS02810 (PV789_02810) | 597435..600026 | + | 2592 | WP_274976032.1 | L-aspartate oxidase | - |
PV789_RS02815 (PV789_02815) | 600091..600873 | + | 783 | WP_274976033.1 | type III pantothenate kinase | - |
PV789_RS02820 (PV789_02820) | 600924..601343 | - | 420 | WP_248773323.1 | PIN domain nuclease | Toxin |
PV789_RS02825 (PV789_02825) | 601348..601563 | - | 216 | WP_212641706.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PV789_RS02830 (PV789_02830) | 601669..602625 | - | 957 | WP_274976034.1 | cation diffusion facilitator family transporter | - |
PV789_RS02835 (PV789_02835) | 602722..604326 | + | 1605 | WP_274978030.1 | bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX | - |
PV789_RS02840 (PV789_02840) | 605029..605352 | + | 324 | WP_212641704.1 | LuxR C-terminal-related transcriptional regulator | - |
PV789_RS02845 (PV789_02845) | 605485..606129 | + | 645 | WP_274976035.1 | amino-acid N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15885.11 Da Isoelectric Point: 6.9594
>T273309 WP_248773323.1 NZ_CP118614:c601343-600924 [Nocardiopsis sp. DZFXJ 01]
VTKTYLLDTSAWLEYLGGTGSETHLFVRQLRDNRENVATTDPVICELLSGAKTEKAFFQLDAMLQAQTRLTVEPTFDFRE
SAMLYRGARSKGKTIRKHMDCLIAAVALRTDAVLVHCDRDFDHLAEVFPRLRVQRHDQD
VTKTYLLDTSAWLEYLGGTGSETHLFVRQLRDNRENVATTDPVICELLSGAKTEKAFFQLDAMLQAQTRLTVEPTFDFRE
SAMLYRGARSKGKTIRKHMDCLIAAVALRTDAVLVHCDRDFDHLAEVFPRLRVQRHDQD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|