Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 374873..375504 | Replicon | chromosome |
| Accession | NZ_CP118614 | ||
| Organism | Nocardiopsis sp. DZFXJ 01 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PV789_RS01805 | Protein ID | WP_274975872.1 |
| Coordinates | 375103..375504 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PV789_RS01800 | Protein ID | WP_274975871.1 |
| Coordinates | 374873..375103 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PV789_RS01785 (PV789_01785) | 371861..372502 | - | 642 | WP_274975868.1 | DUF1449 family protein | - |
| PV789_RS01790 (PV789_01790) | 372881..373321 | + | 441 | WP_274975869.1 | YciI family protein | - |
| PV789_RS01795 (PV789_01795) | 373476..374738 | + | 1263 | WP_274975870.1 | RNA polymerase sigma factor | - |
| PV789_RS01800 (PV789_01800) | 374873..375103 | + | 231 | WP_274975871.1 | hypothetical protein | Antitoxin |
| PV789_RS01805 (PV789_01805) | 375103..375504 | + | 402 | WP_274975872.1 | PIN domain-containing protein | Toxin |
| PV789_RS01810 (PV789_01810) | 375605..376591 | + | 987 | WP_274975873.1 | NAD-dependent epimerase/dehydratase family protein | - |
| PV789_RS01815 (PV789_01815) | 376672..376935 | + | 264 | WP_274975874.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| PV789_RS01820 (PV789_01820) | 377105..379720 | - | 2616 | WP_274975875.1 | ATP-dependent chaperone ClpB | - |
| PV789_RS01825 (PV789_01825) | 379807..380292 | - | 486 | WP_248773132.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 353691..380292 | 26601 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14491.50 Da Isoelectric Point: 5.1190
>T273308 WP_274975872.1 NZ_CP118614:375103-375504 [Nocardiopsis sp. DZFXJ 01]
MAVLLDANVLIALVVDDHVHHRAAEAWITEVDTAFATCPITQGSLVRLLLREGQDAEIARRVVAALAADERHEFWPDSIA
YTDVIMHGVIGHRQVTDAYLAQLARVHDGRLATFDQGLAKLHGDVAELVPTPG
MAVLLDANVLIALVVDDHVHHRAAEAWITEVDTAFATCPITQGSLVRLLLREGQDAEIARRVVAALAADERHEFWPDSIA
YTDVIMHGVIGHRQVTDAYLAQLARVHDGRLATFDQGLAKLHGDVAELVPTPG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|