Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 353470..354092 | Replicon | chromosome |
| Accession | NZ_CP118614 | ||
| Organism | Nocardiopsis sp. DZFXJ 01 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PV789_RS01710 | Protein ID | WP_274978016.1 |
| Coordinates | 353688..354092 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PV789_RS01705 | Protein ID | WP_017563380.1 |
| Coordinates | 353470..353691 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PV789_RS01685 (PV789_01685) | 349184..350470 | + | 1287 | WP_274975852.1 | MFS transporter | - |
| PV789_RS01690 (PV789_01690) | 350776..351240 | + | 465 | WP_274975853.1 | TIGR03668 family PPOX class F420-dependent oxidoreductase | - |
| PV789_RS01695 (PV789_01695) | 351470..352303 | - | 834 | WP_274975854.1 | SDR family oxidoreductase | - |
| PV789_RS01700 (PV789_01700) | 352520..353314 | + | 795 | WP_274975855.1 | GNAT family N-acetyltransferase | - |
| PV789_RS01705 (PV789_01705) | 353470..353691 | + | 222 | WP_017563380.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PV789_RS01710 (PV789_01710) | 353688..354092 | + | 405 | WP_274978016.1 | PIN domain nuclease | Toxin |
| PV789_RS01715 (PV789_01715) | 354172..355989 | - | 1818 | WP_274975856.1 | acyl-CoA dehydrogenase | - |
| PV789_RS01720 (PV789_01720) | 356228..356731 | - | 504 | WP_274975857.1 | ATP-binding protein | - |
| PV789_RS01725 (PV789_01725) | 357133..357501 | - | 369 | Protein_333 | hypothetical protein | - |
| PV789_RS01730 (PV789_01730) | 357853..358050 | - | 198 | WP_274975858.1 | DUF397 domain-containing protein | - |
| PV789_RS01735 (PV789_01735) | 358095..358907 | - | 813 | WP_274975859.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14791.22 Da Isoelectric Point: 5.2252
>T273307 WP_274978016.1 NZ_CP118614:353688-354092 [Nocardiopsis sp. DZFXJ 01]
MMWLIDKSAFVRLAASPDAQEWATRIERGMVRISTVTRLEVGFSARTGGELRNFLGRPPLAVMPVEYVTPAMEDRAVEVQ
AMLADRGQHRAPGIPDLLIAAVAELAGLTLLHLDKDFELIAEITGQPVERLRTV
MMWLIDKSAFVRLAASPDAQEWATRIERGMVRISTVTRLEVGFSARTGGELRNFLGRPPLAVMPVEYVTPAMEDRAVEVQ
AMLADRGQHRAPGIPDLLIAAVAELAGLTLLHLDKDFELIAEITGQPVERLRTV
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|