Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 594089..594759 | Replicon | plasmid pCTYH.Ch1_2 |
Accession | NZ_CP118612 | ||
Organism | Ensifer adhaerens strain CTYH.Ch1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PWG15_RS35740 | Protein ID | WP_275027612.1 |
Coordinates | 594089..594508 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PWG15_RS35745 | Protein ID | WP_275027613.1 |
Coordinates | 594505..594759 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWG15_RS35725 (PWG15_35720) | 589300..592365 | + | 3066 | WP_275027609.1 | GAF domain-containing protein | - |
PWG15_RS35730 (PWG15_35725) | 592362..592751 | + | 390 | WP_275027611.1 | response regulator | - |
PWG15_RS35735 (PWG15_35730) | 592748..594007 | + | 1260 | WP_275028014.1 | adenylate/guanylate cyclase domain-containing protein | - |
PWG15_RS35740 (PWG15_35735) | 594089..594508 | - | 420 | WP_275027612.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PWG15_RS35745 (PWG15_35740) | 594505..594759 | - | 255 | WP_275027613.1 | plasmid stabilization protein | Antitoxin |
PWG15_RS35750 (PWG15_35745) | 595568..596053 | + | 486 | WP_275027614.1 | adenosine-specific kinase | - |
PWG15_RS35755 (PWG15_35750) | 596404..596703 | + | 300 | WP_275027615.1 | HigA family addiction module antitoxin | - |
PWG15_RS35760 (PWG15_35755) | 596921..597154 | + | 234 | WP_275027616.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
PWG15_RS35765 (PWG15_35760) | 597151..597561 | + | 411 | Protein_601 | type II toxin-antitoxin system VapC family toxin | - |
PWG15_RS35770 (PWG15_35765) | 597763..599289 | - | 1527 | WP_275027618.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB | 1..623840 | 623840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14765.95 Da Isoelectric Point: 4.8311
>T273306 WP_275027612.1 NZ_CP118612:c594508-594089 [Ensifer adhaerens]
MIVLDTNVVSEAMKPAPDLAVRTWLNDQVAETLYLSSVTLAELLFGIAALPEGRRKKALAETLDGLLALFDDRVLPFDTA
AARHYADLAATARAAGKGFPTPDGYIAAIVASKGFTIATRDTSPFEAAGVPVVNPWTHL
MIVLDTNVVSEAMKPAPDLAVRTWLNDQVAETLYLSSVTLAELLFGIAALPEGRRKKALAETLDGLLALFDDRVLPFDTA
AARHYADLAATARAAGKGFPTPDGYIAAIVASKGFTIATRDTSPFEAAGVPVVNPWTHL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|