Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 682083..682873 | Replicon | plasmid pCTYH.Ch1_1 |
Accession | NZ_CP118611 | ||
Organism | Ensifer adhaerens strain CTYH.Ch1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | PWG15_RS23505 | Protein ID | WP_275026442.1 |
Coordinates | 682376..682873 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0T7A4X6 |
Locus tag | PWG15_RS23500 | Protein ID | WP_058321439.1 |
Coordinates | 682083..682379 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWG15_RS23475 (PWG15_23470) | 677496..678047 | + | 552 | WP_275026437.1 | MaoC family dehydratase | - |
PWG15_RS23480 (PWG15_23475) | 678055..679215 | + | 1161 | WP_275026438.1 | CaiB/BaiF CoA-transferase family protein | - |
PWG15_RS23485 (PWG15_23480) | 679212..680348 | + | 1137 | WP_275026439.1 | extracellular solute-binding protein | - |
PWG15_RS23490 (PWG15_23485) | 680519..681445 | + | 927 | WP_275027184.1 | nucleotidyltransferase and HEPN domain-containing protein | - |
PWG15_RS23495 (PWG15_23490) | 681723..681893 | - | 171 | WP_275026440.1 | ATP-binding cassette domain-containing protein | - |
PWG15_RS23500 (PWG15_23495) | 682083..682379 | + | 297 | WP_058321439.1 | DUF1778 domain-containing protein | Antitoxin |
PWG15_RS23505 (PWG15_23500) | 682376..682873 | + | 498 | WP_275026442.1 | GNAT family N-acetyltransferase | Toxin |
PWG15_RS23510 (PWG15_23505) | 683213..683371 | - | 159 | WP_275026444.1 | hypothetical protein | - |
PWG15_RS23515 (PWG15_23510) | 683462..684298 | - | 837 | WP_275026446.1 | amidohydrolase | - |
PWG15_RS23520 (PWG15_23515) | 684375..685163 | - | 789 | WP_275026448.1 | IclR family transcriptional regulator | - |
PWG15_RS23525 (PWG15_23520) | 685328..686647 | + | 1320 | WP_275027186.1 | extracellular solute-binding protein | - |
PWG15_RS23530 (PWG15_23525) | 686729..687625 | + | 897 | WP_275026450.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | wcbK / katA | 1..2779603 | 2779603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17823.45 Da Isoelectric Point: 8.0520
>T273303 WP_275026442.1 NZ_CP118611:682376-682873 [Ensifer adhaerens]
VSLNAPTPLADQHELADFNSGVPELDDWLRRRARTNQIGGASRTFVVCEGNRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDGAYQGRGIGRALVRDAGFRLLNAAEILGIRGVLVHAISEDARAFYEAVGFLPSPSDPMMLMVGLHDLK
SALNF
VSLNAPTPLADQHELADFNSGVPELDDWLRRRARTNQIGGASRTFVVCEGNRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDGAYQGRGIGRALVRDAGFRLLNAAEILGIRGVLVHAISEDARAFYEAVGFLPSPSDPMMLMVGLHDLK
SALNF
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|