Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 5197557..5198206 | Replicon | chromosome |
Accession | NZ_CP118607 | ||
Organism | Pseudomonas sp. PSKL.D1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PVV54_RS23250 | Protein ID | WP_274907473.1 |
Coordinates | 5197787..5198206 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PVV54_RS23245 | Protein ID | WP_274907472.1 |
Coordinates | 5197557..5197787 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVV54_RS23225 (PVV54_23225) | 5193021..5194349 | - | 1329 | WP_274907469.1 | precorrin-3B synthase | - |
PVV54_RS23230 (PVV54_23230) | 5194451..5195662 | + | 1212 | WP_274910489.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
PVV54_RS23235 (PVV54_23235) | 5195655..5196749 | + | 1095 | WP_274907470.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
PVV54_RS23240 (PVV54_23240) | 5196746..5197462 | + | 717 | WP_274907471.1 | cobalt-precorrin-6A reductase | - |
PVV54_RS23245 (PVV54_23245) | 5197557..5197787 | + | 231 | WP_274907472.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PVV54_RS23250 (PVV54_23250) | 5197787..5198206 | + | 420 | WP_274907473.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PVV54_RS23255 (PVV54_23255) | 5198326..5198763 | + | 438 | WP_274907474.1 | NfeD family protein | - |
PVV54_RS23260 (PVV54_23260) | 5198789..5199643 | + | 855 | WP_274907475.1 | SPFH domain-containing protein | - |
PVV54_RS23265 (PVV54_23265) | 5199753..5200142 | + | 390 | WP_274907476.1 | DUF2946 domain-containing protein | - |
PVV54_RS23270 (PVV54_23270) | 5200191..5200676 | + | 486 | WP_274907477.1 | copper chaperone PCu(A)C | - |
PVV54_RS23275 (PVV54_23275) | 5200702..5201127 | + | 426 | WP_274907478.1 | DUF2946 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15538.79 Da Isoelectric Point: 6.8715
>T273301 WP_274907473.1 NZ_CP118607:5197787-5198206 [Pseudomonas sp. PSKL.D1]
MLRYMLDTNICIFTIKNKPQQVREAFNRHHGQMAISTVTLMELVYGAEKSAYPDRNLTIVEGFAARLEVVEYDSLAAEHS
GQLRAELAKAGTPIGPYDQLIAGHARARGLVLVTNNLREFQRVPGLRVEDWLISPTDSA
MLRYMLDTNICIFTIKNKPQQVREAFNRHHGQMAISTVTLMELVYGAEKSAYPDRNLTIVEGFAARLEVVEYDSLAAEHS
GQLRAELAKAGTPIGPYDQLIAGHARARGLVLVTNNLREFQRVPGLRVEDWLISPTDSA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|