Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1588983..1589571 | Replicon | chromosome |
Accession | NZ_CP118607 | ||
Organism | Pseudomonas sp. PSKL.D1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PVV54_RS06995 | Protein ID | WP_274909235.1 |
Coordinates | 1589269..1589571 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PVV54_RS06990 | Protein ID | WP_274909234.1 |
Coordinates | 1588983..1589276 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVV54_RS06960 (PVV54_06960) | 1584207..1584467 | - | 261 | Protein_1362 | mechanosensitive ion channel family protein | - |
PVV54_RS06965 (PVV54_06965) | 1584913..1585155 | + | 243 | WP_274909229.1 | hypothetical protein | - |
PVV54_RS06970 (PVV54_06970) | 1585237..1585506 | + | 270 | WP_274909230.1 | DUF3077 domain-containing protein | - |
PVV54_RS06975 (PVV54_06975) | 1585644..1586942 | - | 1299 | WP_274909231.1 | mechanosensitive ion channel family protein | - |
PVV54_RS06980 (PVV54_06980) | 1587047..1588408 | + | 1362 | WP_274909232.1 | DEAD/DEAH box helicase | - |
PVV54_RS06985 (PVV54_06985) | 1588588..1588860 | - | 273 | WP_274909233.1 | hypothetical protein | - |
PVV54_RS06990 (PVV54_06990) | 1588983..1589276 | - | 294 | WP_274909234.1 | putative addiction module antidote protein | Antitoxin |
PVV54_RS06995 (PVV54_06995) | 1589269..1589571 | - | 303 | WP_274909235.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVV54_RS07000 (PVV54_07000) | 1589872..1590798 | + | 927 | WP_274909236.1 | DMT family transporter | - |
PVV54_RS07005 (PVV54_07005) | 1590740..1591930 | - | 1191 | WP_274909237.1 | MFS transporter | - |
PVV54_RS07010 (PVV54_07010) | 1592037..1592930 | + | 894 | WP_274909238.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11313.10 Da Isoelectric Point: 10.7302
>T273298 WP_274909235.1 NZ_CP118607:c1589571-1589269 [Pseudomonas sp. PSKL.D1]
MKKIESSSFRKWVIGLKDAKARVRIISRINRLMEGISGDVSPVGHGVSELRIHLGPGYRVYFHQSGDTLVILLCGGDKDS
QQRDIKAAHQILRAWRMQND
MKKIESSSFRKWVIGLKDAKARVRIISRINRLMEGISGDVSPVGHGVSELRIHLGPGYRVYFHQSGDTLVILLCGGDKDS
QQRDIKAAHQILRAWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|