Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 867487..868118 Replicon chromosome
Accession NZ_CP118607
Organism Pseudomonas sp. PSKL.D1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag PVV54_RS03690 Protein ID WP_274908645.1
Coordinates 867487..867714 (+) Length 76 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PVV54_RS03695 Protein ID WP_274908646.1
Coordinates 867711..868118 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVV54_RS03670 (PVV54_03670) 863090..863521 - 432 WP_274908641.1 hypothetical protein -
PVV54_RS03675 (PVV54_03675) 863518..864897 - 1380 WP_274908642.1 phosphatase PAP2/dual specificity phosphatase family protein -
PVV54_RS03680 (PVV54_03680) 864894..866651 - 1758 WP_274908643.1 bifunctional alpha/beta hydrolase/class I SAM-dependent methyltransferase -
PVV54_RS03685 (PVV54_03685) 866682..867287 - 606 WP_274908644.1 CDP-alcohol phosphatidyltransferase family protein -
PVV54_RS03690 (PVV54_03690) 867487..867714 + 228 WP_274908645.1 type II toxin-antitoxin system HicA family toxin Toxin
PVV54_RS03695 (PVV54_03695) 867711..868118 + 408 WP_274908646.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PVV54_RS03700 (PVV54_03700) 868169..868933 + 765 WP_274908647.1 sulfite exporter TauE/SafE family protein -
PVV54_RS03705 (PVV54_03705) 868923..869237 - 315 WP_274908648.1 putative quinol monooxygenase -
PVV54_RS03710 (PVV54_03710) 869397..869987 + 591 WP_274908649.1 NAD(P)H-dependent oxidoreductase -
PVV54_RS03715 (PVV54_03715) 870055..870951 + 897 WP_274908650.1 LysR family transcriptional regulator -
PVV54_RS03720 (PVV54_03720) 871070..872737 + 1668 WP_274908651.1 gamma-glutamyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 855619..868118 12499


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 76 a.a.        Molecular weight: 8337.64 Da        Isoelectric Point: 10.6227

>T273296 WP_274908645.1 NZ_CP118607:867487-867714 [Pseudomonas sp. PSKL.D1]
MRSRDVIQIIEADGWYLVDVKGSHHQFKHPAKKGRVTVPHPKTDLPKGTVHNILKQAGLKQTRCVNSPNITGGCQ

Download         Length: 228 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14751.65 Da        Isoelectric Point: 4.8983

>AT273296 WP_274908646.1 NZ_CP118607:867711-868118 [Pseudomonas sp. PSKL.D1]
MKFPVVLHKDHGSDYGVTVPDVPGCFSAGCNVAEALDNVQEALSLHFEGLVADNEPLPQAQEIDVHVVNPDYVGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELALAH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References