Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 867487..868118 | Replicon | chromosome |
| Accession | NZ_CP118607 | ||
| Organism | Pseudomonas sp. PSKL.D1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PVV54_RS03690 | Protein ID | WP_274908645.1 |
| Coordinates | 867487..867714 (+) | Length | 76 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PVV54_RS03695 | Protein ID | WP_274908646.1 |
| Coordinates | 867711..868118 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVV54_RS03670 (PVV54_03670) | 863090..863521 | - | 432 | WP_274908641.1 | hypothetical protein | - |
| PVV54_RS03675 (PVV54_03675) | 863518..864897 | - | 1380 | WP_274908642.1 | phosphatase PAP2/dual specificity phosphatase family protein | - |
| PVV54_RS03680 (PVV54_03680) | 864894..866651 | - | 1758 | WP_274908643.1 | bifunctional alpha/beta hydrolase/class I SAM-dependent methyltransferase | - |
| PVV54_RS03685 (PVV54_03685) | 866682..867287 | - | 606 | WP_274908644.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| PVV54_RS03690 (PVV54_03690) | 867487..867714 | + | 228 | WP_274908645.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PVV54_RS03695 (PVV54_03695) | 867711..868118 | + | 408 | WP_274908646.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PVV54_RS03700 (PVV54_03700) | 868169..868933 | + | 765 | WP_274908647.1 | sulfite exporter TauE/SafE family protein | - |
| PVV54_RS03705 (PVV54_03705) | 868923..869237 | - | 315 | WP_274908648.1 | putative quinol monooxygenase | - |
| PVV54_RS03710 (PVV54_03710) | 869397..869987 | + | 591 | WP_274908649.1 | NAD(P)H-dependent oxidoreductase | - |
| PVV54_RS03715 (PVV54_03715) | 870055..870951 | + | 897 | WP_274908650.1 | LysR family transcriptional regulator | - |
| PVV54_RS03720 (PVV54_03720) | 871070..872737 | + | 1668 | WP_274908651.1 | gamma-glutamyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 855619..868118 | 12499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 76 a.a. Molecular weight: 8337.64 Da Isoelectric Point: 10.6227
>T273296 WP_274908645.1 NZ_CP118607:867487-867714 [Pseudomonas sp. PSKL.D1]
MRSRDVIQIIEADGWYLVDVKGSHHQFKHPAKKGRVTVPHPKTDLPKGTVHNILKQAGLKQTRCVNSPNITGGCQ
MRSRDVIQIIEADGWYLVDVKGSHHQFKHPAKKGRVTVPHPKTDLPKGTVHNILKQAGLKQTRCVNSPNITGGCQ
Download Length: 228 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14751.65 Da Isoelectric Point: 4.8983
>AT273296 WP_274908646.1 NZ_CP118607:867711-868118 [Pseudomonas sp. PSKL.D1]
MKFPVVLHKDHGSDYGVTVPDVPGCFSAGCNVAEALDNVQEALSLHFEGLVADNEPLPQAQEIDVHVVNPDYVGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELALAH
MKFPVVLHKDHGSDYGVTVPDVPGCFSAGCNVAEALDNVQEALSLHFEGLVADNEPLPQAQEIDVHVVNPDYVGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELALAH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|