273294

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7053..7546 Replicon plasmid pNB4833-NDM-13
Accession NZ_CP118604
Organism Escherichia coli strain NB4833

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag OU688_RS25650 Protein ID WP_001230709.1
Coordinates 7053..7307 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag OU688_RS25655 Protein ID WP_000151456.1
Coordinates 7304..7546 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU688_RS25610 (OU688_25610) 2570..2722 + 153 Protein_2 DUF5431 family protein -
OU688_RS25615 (OU688_25615) 2667..2789 + 123 WP_223685802.1 Hok/Gef family protein -
OU688_RS25620 (OU688_25620) 2939..3535 + 597 WP_000125165.1 ProQ/FINO family protein -
OU688_RS25625 (OU688_25625) 3553..3837 - 285 WP_001162371.1 hypothetical protein -
OU688_RS25630 (OU688_25630) 3911..4576 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
OU688_RS25635 (OU688_25635) 5165..5494 + 330 WP_001542022.1 hypothetical protein -
OU688_RS25640 (OU688_25640) 5895..6410 + 516 WP_001025393.1 J domain-containing protein -
OU688_RS25645 (OU688_25645) 6514..7056 + 543 WP_001083904.1 hypothetical protein -
OU688_RS25650 (OU688_25650) 7053..7307 + 255 WP_001230709.1 hypothetical protein Toxin
OU688_RS25655 (OU688_25655) 7304..7546 + 243 WP_000151456.1 hypothetical protein Antitoxin
OU688_RS25660 (OU688_25660) 8117..8410 + 294 WP_000673428.1 hypothetical protein -
OU688_RS25665 (OU688_25665) 8899..9147 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
OU688_RS25670 (OU688_25670) 9144..9491 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
OU688_RS25675 (OU688_25675) 9579..10022 - 444 WP_023223351.1 hypothetical protein -
OU688_RS25680 (OU688_25680) 10263..10562 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
OU688_RS25685 (OU688_25685) 10822..11148 - 327 WP_000206697.1 hypothetical protein -
OU688_RS25690 (OU688_25690) 11150..11473 - 324 WP_223666488.1 hypothetical protein -
OU688_RS25695 (OU688_25695) 11450..11590 - 141 Protein_19 hypothetical protein -
OU688_RS25700 (OU688_25700) 11610..12317 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..60980 60980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T273294 WP_001230709.1 NZ_CP118604:7053-7307 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT273294 WP_000151456.1 NZ_CP118604:7304-7546 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References