Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2627671..2628309 | Replicon | chromosome |
Accession | NZ_CP118601 | ||
Organism | Escherichia coli strain NB4833 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OU688_RS12660 | Protein ID | WP_000813794.1 |
Coordinates | 2628133..2628309 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OU688_RS12655 | Protein ID | WP_001270286.1 |
Coordinates | 2627671..2628087 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU688_RS12635 (2622823) | 2622823..2623764 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
OU688_RS12640 (2623765) | 2623765..2624778 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
OU688_RS12645 (2624796) | 2624796..2625941 | - | 1146 | WP_113975712.1 | ABC transporter substrate-binding protein | - |
OU688_RS12650 (2626186) | 2626186..2627592 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
OU688_RS12655 (2627671) | 2627671..2628087 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OU688_RS12660 (2628133) | 2628133..2628309 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OU688_RS12665 (2628531) | 2628531..2628761 | + | 231 | WP_000494244.1 | YncJ family protein | - |
OU688_RS12670 (2628853) | 2628853..2630814 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OU688_RS12675 (2630887) | 2630887..2631423 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OU688_RS12680 (2631515) | 2631515..2632690 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T273281 WP_000813794.1 NZ_CP118601:c2628309-2628133 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT273281 WP_001270286.1 NZ_CP118601:c2628087-2627671 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|