Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1418967..1419592 | Replicon | chromosome |
| Accession | NZ_CP118601 | ||
| Organism | Escherichia coli strain NB4833 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | OU688_RS06900 | Protein ID | WP_000911329.1 |
| Coordinates | 1419194..1419592 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | OU688_RS06895 | Protein ID | WP_000450524.1 |
| Coordinates | 1418967..1419194 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU688_RS06870 (1414769) | 1414769..1415239 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| OU688_RS06875 (1415239) | 1415239..1415811 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| OU688_RS06880 (1415957) | 1415957..1416835 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| OU688_RS06885 (1416852) | 1416852..1417886 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| OU688_RS06890 (1418099) | 1418099..1418812 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| OU688_RS06895 (1418967) | 1418967..1419194 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| OU688_RS06900 (1419194) | 1419194..1419592 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OU688_RS06905 (1419739) | 1419739..1420602 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| OU688_RS06910 (1420617) | 1420617..1422632 | + | 2016 | WP_000829293.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| OU688_RS06915 (1422706) | 1422706..1423404 | + | 699 | WP_000679823.1 | esterase | - |
| OU688_RS06920 (1423514) | 1423514..1423714 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T273273 WP_000911329.1 NZ_CP118601:1419194-1419592 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |