Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 989500..990154 | Replicon | chromosome |
| Accession | NZ_CP118601 | ||
| Organism | Escherichia coli strain NB4833 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OU688_RS04860 | Protein ID | WP_113975638.1 |
| Coordinates | 989747..990154 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | OU688_RS04855 | Protein ID | WP_000354046.1 |
| Coordinates | 989500..989766 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU688_RS04830 (984788) | 984788..985531 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| OU688_RS04835 (985588) | 985588..987021 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| OU688_RS04840 (987066) | 987066..987377 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| OU688_RS04845 (987541) | 987541..988200 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| OU688_RS04850 (988277) | 988277..989257 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| OU688_RS04855 (989500) | 989500..989766 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| OU688_RS04860 (989747) | 989747..990154 | + | 408 | WP_113975638.1 | protein YgfX | Toxin |
| OU688_RS04865 (990194) | 990194..990715 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| OU688_RS04870 (990827) | 990827..991723 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| OU688_RS04875 (991748) | 991748..992458 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OU688_RS04880 (992464) | 992464..994197 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15994.97 Da Isoelectric Point: 10.5673
>T273271 WP_113975638.1 NZ_CP118601:989747-990154 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGCLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGCLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |