Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 808828..809663 Replicon chromosome
Accession NZ_CP118601
Organism Escherichia coli strain NB4833

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag OU688_RS03940 Protein ID WP_029402447.1
Coordinates 808828..809205 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3Z2YIX3
Locus tag OU688_RS03945 Protein ID WP_032178229.1
Coordinates 809295..809663 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU688_RS03905 (804669) 804669..805847 + 1179 WP_033547699.1 type II secretion system protein GspL -
OU688_RS03910 (805849) 805849..806385 + 537 WP_000942795.1 GspM family type II secretion system protein YghD -
OU688_RS03915 (806800) 806800..807126 - 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
OU688_RS03920 (807123) 807123..807386 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
OU688_RS03925 (807458) 807458..808324 - 867 WP_039023551.1 DUF4942 domain-containing protein -
OU688_RS03930 (808409) 808409..808606 - 198 WP_088172489.1 DUF957 domain-containing protein -
OU688_RS03935 (808682) 808682..808831 - 150 Protein_772 DUF5983 family protein -
OU688_RS03940 (808828) 808828..809205 - 378 WP_029402447.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
OU688_RS03945 (809295) 809295..809663 - 369 WP_032178229.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OU688_RS03950 (809713) 809713..810357 - 645 WP_060615859.1 hypothetical protein -
OU688_RS03955 (810376) 810376..810597 - 222 WP_029402821.1 DUF987 domain-containing protein -
OU688_RS03960 (810666) 810666..811142 - 477 WP_001186771.1 RadC family protein -
OU688_RS03965 (811158) 811158..811643 - 486 WP_071045790.1 antirestriction protein -
OU688_RS03970 (811735) 811735..812553 - 819 WP_024214765.1 DUF932 domain-containing protein -
OU688_RS03975 (812643) 812643..812876 - 234 WP_087526090.1 DUF905 family protein -
OU688_RS03980 (812882) 812882..813559 - 678 WP_001097301.1 hypothetical protein -
OU688_RS03985 (813707) 813707..814387 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13900.92 Da        Isoelectric Point: 8.5163

>T273270 WP_029402447.1 NZ_CP118601:c809205-808828 [Escherichia coli]
MKTLPVLPGQAAGSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13823.58 Da        Isoelectric Point: 6.3177

>AT273270 WP_032178229.1 NZ_CP118601:c809663-809295 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3Z2YIX3

References