Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1664524..1665073 Replicon chromosome
Accession NZ_CP118596
Organism Vibrio harveyi strain fish10

Toxin (Protein)


Gene name parE Uniprot ID A0A2K7SRW8
Locus tag PWW26_RS08315 Protein ID WP_015296889.1
Coordinates 1664524..1664823 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A347UQT2
Locus tag PWW26_RS08320 Protein ID WP_005442033.1
Coordinates 1664831..1665073 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW26_RS08255 1659805..1659921 + 117 WP_274878923.1 DUF3265 domain-containing protein -
PWW26_RS08260 1659970..1660647 + 678 WP_274878924.1 restriction endonuclease -
PWW26_RS08265 1660611..1660766 + 156 WP_274878925.1 DUF3265 domain-containing protein -
PWW26_RS08270 1660800..1661276 + 477 WP_215810674.1 GNAT family N-acetyltransferase -
PWW26_RS08275 1661261..1661329 + 69 Protein_1549 DUF3265 domain-containing protein -
PWW26_RS08280 1662012..1662401 + 390 WP_274878926.1 DUF4345 domain-containing protein -
PWW26_RS08285 1662419..1662508 + 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW26_RS08290 1662927..1663056 + 130 Protein_1552 DUF3265 domain-containing protein -
PWW26_RS08295 1663087..1663608 + 522 WP_045373335.1 GNAT family N-acetyltransferase -
PWW26_RS08300 1663731..1664009 - 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
PWW26_RS08305 1664006..1664290 - 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
PWW26_RS08310 1664310..1664427 + 118 Protein_1556 DUF3265 domain-containing protein -
PWW26_RS08315 1664524..1664823 - 300 WP_015296889.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW26_RS08320 1664831..1665073 - 243 WP_005442033.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW26_RS08325 1665187..1665276 + 90 WP_274879049.1 DUF3265 domain-containing protein -
PWW26_RS08330 1665286..1666509 + 1224 WP_274878927.1 hypothetical protein -
PWW26_RS08335 1666643..1667659 + 1017 WP_274878928.1 DUF2806 domain-containing protein -
PWW26_RS08340 1667789..1668658 + 870 WP_274878929.1 hypothetical protein -
PWW26_RS08345 1668686..1668778 + 93 WP_078555087.1 DUF3265 domain-containing protein -
PWW26_RS08350 1668820..1669464 + 645 WP_061065168.1 peptidase E -
PWW26_RS08355 1669479..1669570 + 92 Protein_1565 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1601663..1696704 95041
- inside Integron - - 1600447..1691704 91257


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-55)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11502.11 Da        Isoelectric Point: 9.3224

>T273265 WP_015296889.1 NZ_CP118596:c1664823-1664524 [Vibrio harveyi]
MQKNKYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9047.26 Da        Isoelectric Point: 5.6926

>AT273265 WP_005442033.1 NZ_CP118596:c1665073-1664831 [Vibrio harveyi]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDTVVVMSIRDFEELEAMKVEYLKHCFKSAKEDLNNGNTVDGESFLNSL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SRW8

Antitoxin

Source ID Structure
AlphaFold DB A0A347UQT2

References