Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 1664524..1665073 | Replicon | chromosome |
| Accession | NZ_CP118596 | ||
| Organism | Vibrio harveyi strain fish10 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A2K7SRW8 |
| Locus tag | PWW26_RS08315 | Protein ID | WP_015296889.1 |
| Coordinates | 1664524..1664823 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A347UQT2 |
| Locus tag | PWW26_RS08320 | Protein ID | WP_005442033.1 |
| Coordinates | 1664831..1665073 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWW26_RS08255 | 1659805..1659921 | + | 117 | WP_274878923.1 | DUF3265 domain-containing protein | - |
| PWW26_RS08260 | 1659970..1660647 | + | 678 | WP_274878924.1 | restriction endonuclease | - |
| PWW26_RS08265 | 1660611..1660766 | + | 156 | WP_274878925.1 | DUF3265 domain-containing protein | - |
| PWW26_RS08270 | 1660800..1661276 | + | 477 | WP_215810674.1 | GNAT family N-acetyltransferase | - |
| PWW26_RS08275 | 1661261..1661329 | + | 69 | Protein_1549 | DUF3265 domain-containing protein | - |
| PWW26_RS08280 | 1662012..1662401 | + | 390 | WP_274878926.1 | DUF4345 domain-containing protein | - |
| PWW26_RS08285 | 1662419..1662508 | + | 90 | WP_071881309.1 | DUF3265 domain-containing protein | - |
| PWW26_RS08290 | 1662927..1663056 | + | 130 | Protein_1552 | DUF3265 domain-containing protein | - |
| PWW26_RS08295 | 1663087..1663608 | + | 522 | WP_045373335.1 | GNAT family N-acetyltransferase | - |
| PWW26_RS08300 | 1663731..1664009 | - | 279 | WP_005398411.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| PWW26_RS08305 | 1664006..1664290 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| PWW26_RS08310 | 1664310..1664427 | + | 118 | Protein_1556 | DUF3265 domain-containing protein | - |
| PWW26_RS08315 | 1664524..1664823 | - | 300 | WP_015296889.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWW26_RS08320 | 1664831..1665073 | - | 243 | WP_005442033.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PWW26_RS08325 | 1665187..1665276 | + | 90 | WP_274879049.1 | DUF3265 domain-containing protein | - |
| PWW26_RS08330 | 1665286..1666509 | + | 1224 | WP_274878927.1 | hypothetical protein | - |
| PWW26_RS08335 | 1666643..1667659 | + | 1017 | WP_274878928.1 | DUF2806 domain-containing protein | - |
| PWW26_RS08340 | 1667789..1668658 | + | 870 | WP_274878929.1 | hypothetical protein | - |
| PWW26_RS08345 | 1668686..1668778 | + | 93 | WP_078555087.1 | DUF3265 domain-containing protein | - |
| PWW26_RS08350 | 1668820..1669464 | + | 645 | WP_061065168.1 | peptidase E | - |
| PWW26_RS08355 | 1669479..1669570 | + | 92 | Protein_1565 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1601663..1696704 | 95041 | |
| - | inside | Integron | - | - | 1600447..1691704 | 91257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11502.11 Da Isoelectric Point: 9.3224
>T273265 WP_015296889.1 NZ_CP118596:c1664823-1664524 [Vibrio harveyi]
MQKNKYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK
MQKNKYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K7SRW8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A347UQT2 |