273263

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1644174..1644723 Replicon chromosome
Accession NZ_CP118596
Organism Vibrio harveyi strain fish10

Toxin (Protein)


Gene name parE Uniprot ID A0A2K7SRW8
Locus tag PWW26_RS08045 Protein ID WP_015296889.1
Coordinates 1644174..1644473 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A347UQT2
Locus tag PWW26_RS08050 Protein ID WP_005442033.1
Coordinates 1644481..1644723 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW26_RS07995 1639326..1639418 + 93 WP_199539653.1 DUF3265 domain-containing protein -
PWW26_RS08000 1639446..1639955 + 510 WP_017048678.1 ClbS/DfsB family four-helix bundle protein -
PWW26_RS08005 1639970..1640062 + 93 WP_004748931.1 DUF3265 domain-containing protein -
PWW26_RS08010 1640593..1641354 + 762 WP_274878895.1 hypothetical protein -
PWW26_RS08015 1641517..1642461 + 945 WP_274878896.1 D-2-hydroxyacid dehydrogenase family protein -
PWW26_RS08020 1642506..1642598 + 93 WP_005536857.1 DUF3265 domain-containing protein -
PWW26_RS08025 1642685..1643290 + 606 WP_274878897.1 hypothetical protein -
PWW26_RS08030 1643293..1643499 + 207 WP_274878898.1 hypothetical protein -
PWW26_RS08035 1643650..1644003 + 354 WP_033907397.1 glyoxalase/bleomycin resistance/dioxygenase family protein -
PWW26_RS08040 1644018..1644110 + 93 WP_274878899.1 DUF3265 domain-containing protein -
PWW26_RS08045 1644174..1644473 - 300 WP_015296889.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW26_RS08050 1644481..1644723 - 243 WP_005442033.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW26_RS08055 1644837..1644926 + 90 WP_274879049.1 DUF3265 domain-containing protein -
PWW26_RS08060 1645345..1645474 + 130 Protein_1506 DUF3265 domain-containing protein -
PWW26_RS08065 1645506..1645964 + 459 WP_274878902.1 GNAT family N-acetyltransferase -
PWW26_RS08070 1645993..1646082 + 90 WP_079386107.1 DUF3265 domain-containing protein -
PWW26_RS08075 1646501..1646630 + 130 Protein_1509 DUF3265 domain-containing protein -
PWW26_RS08080 1646658..1647041 + 384 WP_025624000.1 hypothetical protein -
PWW26_RS08085 1647022..1647411 + 390 WP_039453119.1 hypothetical protein -
PWW26_RS08090 1647426..1647518 + 93 WP_261916779.1 DUF3265 domain-containing protein -
PWW26_RS08095 1647563..1647847 + 285 WP_025640084.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
PWW26_RS08100 1647855..1647965 + 111 WP_082798391.1 DUF3265 domain-containing protein -
PWW26_RS08105 1647995..1648444 + 450 WP_274878905.1 GNAT family N-acetyltransferase -
PWW26_RS08110 1648474..1648563 + 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW26_RS08115 1649126..1649218 + 93 WP_079877857.1 DUF3265 domain-containing protein -
PWW26_RS08120 1649373..1649675 + 303 WP_038899751.1 BrnT family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1601663..1696704 95041
- inside Integron - - 1600447..1691704 91257


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-55)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11502.11 Da        Isoelectric Point: 9.3224

>T273263 WP_015296889.1 NZ_CP118596:c1644473-1644174 [Vibrio harveyi]
MQKNKYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9047.26 Da        Isoelectric Point: 5.6926

>AT273263 WP_005442033.1 NZ_CP118596:c1644723-1644481 [Vibrio harveyi]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDTVVVMSIRDFEELEAMKVEYLKHCFKSAKEDLNNGNTVDGESFLNSL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SRW8

Antitoxin

Source ID Structure
AlphaFold DB A0A347UQT2

References