Detailed information of TA system TA273262

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relB-yefM/YoeB-RelB
• Location: 1624277..1624793
• Replicon: chromosome
• Accession: NZ_CP118596
• Organism: Vibrio harveyi strain fish10

Toxin (Protein)

• Gene name: relB
• Uniprot ID: A0A244CLX5
• Locus tag: PWW26_RS07825
• Protein ID: WP_069509627.1
• Coordinates: 1624524..1624793 (+)
• Length: 90 a.a.

Antitoxin (Protein)

• Gene name: yefM
• Uniprot ID: U2ZH00
• Locus tag: PWW26_RS07820
• Protein ID: WP_005526636.1
• Coordinates: 1624277..1624531 (+)
• Length: 85 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PWW26_RS07765	1619396..1619782	+	387	WP_050907556.1	hypothetical protein	-
PWW26_RS07770	1619825..1619917	+	93	WP_005446109.1	DUF3265 domain-containing protein	-
PWW26_RS07775	1619966..1620418	+	453	WP_017817942.1	hypothetical protein	-
PWW26_RS07780	1620431..1620754	+	324	WP_017817943.1	TIR domain-containing protein	-
PWW26_RS07785	1620769..1620861	+	93	WP_078534682.1	DUF3265 domain-containing protein	-
PWW26_RS07790	1620891..1621826	+	936	WP_237032088.1	hypothetical protein	-
PWW26_RS07795	1621962..1622399	+	438	WP_274878869.1	GIY-YIG nuclease family protein	-
PWW26_RS07800	1622417..1622506	+	90	WP_072875472.1	DUF3265 domain-containing protein	-
PWW26_RS07805	1622564..1623568	+	1005	WP_274878870.1	GIY-YIG nuclease family protein	-
PWW26_RS07810	1623583..1623675	+	93	WP_274878872.1	DUF3265 domain-containing protein	-
PWW26_RS07815	1623784..1624065	+	282	WP_274878874.1	hypothetical protein	-
PWW26_RS07820	1624277..1624531	+	255	WP_005526636.1	type II toxin-antitoxin system prevent-host-death family antitoxin	Antitoxin
PWW26_RS07825	1624524..1624793	+	270	WP_069509627.1	Txe/YoeB family addiction module toxin	Toxin
PWW26_RS07830	1625025..1625459	+	435	WP_274878877.1	hypothetical protein	-
PWW26_RS07835	1625474..1625566	+	93	WP_193394940.1	DUF3265 domain-containing protein	-
PWW26_RS07840	1625662..1625961	+	300	WP_274878878.1	hypothetical protein	-
PWW26_RS07845	1626551..1626643	+	93	WP_274878879.1	DUF3265 domain-containing protein	-
PWW26_RS07850	1626699..1627280	+	582	WP_114321957.1	hypothetical protein	-
PWW26_RS07855	1627298..1627387	+	90	WP_202905992.1	DUF3265 domain-containing protein	-
PWW26_RS07860	1627418..1628185	+	768	WP_131815243.1	hypothetical protein	-
PWW26_RS07865	1628370..1628636	+	267	WP_274878880.1	hypothetical protein	-
PWW26_RS07870	1628673..1628762	+	90	WP_071881309.1	DUF3265 domain-containing protein	-
PWW26_RS07875	1628731..1629309	+	579	WP_274878882.1	hypothetical protein	-
PWW26_RS07880	1629282..1629362	+	81	Protein_1470	DUF3265 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	1601663..1696704	95041
	-	inside	Integron	-	-	1600447..1691704	91257

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin YoeB (8-89)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-74)

Sequences

Toxin

Protein

• Length: 90 a.a.
• Molecular weight: 10570.95 Da
• Isoelectric Point: 8.8578

>T273262 WP_069509627.1 NZ_CP118596:1624524-1624793 [Vibrio harveyi]
MSSSQRLLSWTDEAWGDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY

Nucleotide

• Length: 270 bp

Antitoxin

Protein

• Length: 85 a.a.
• Molecular weight: 9453.60 Da
• Isoelectric Point: 5.0623

>AT273262 WP_005526636.1 NZ_CP118596:1624277-1624531 [Vibrio harveyi]
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNAEHLNRSIAQYRAGKTTARE
LIDE

Nucleotide

• Length: 255 bp

Structures

Toxin

• AlphaFold DB: A0A244CLX5

Antitoxin

• AlphaFold DB: A0A244CM06