Detailed information of TA system TA273261

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-YafN
• Location: 2569193..2569721
• Replicon: chromosome
• Accession: NZ_CP118590
• Organism: Vibrio harveyi strain fish12

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: PWW24_RS12225
• Protein ID: WP_045382929.1
• Coordinates: 2569431..2569721 (+)
• Length: 97 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: A0A347UR02
• Locus tag: PWW24_RS12220
• Protein ID: WP_005377003.1
• Coordinates: 2569193..2569441 (+)
• Length: 83 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PWW24_RS12150	2564638..2565207	-	570	WP_274882190.1	hypothetical protein	-
PWW24_RS12155	2565309..2565371	-	63	Protein_2316	DUF3265 domain-containing protein	-
PWW24_RS12160	2565362..2565793	-	432	WP_155487907.1	hypothetical protein	-
PWW24_RS12165	2565823..2565915	-	93	WP_274882191.1	DUF3265 domain-containing protein	-
PWW24_RS12170	2565948..2566469	-	522	WP_274882192.1	hypothetical protein	-
PWW24_RS12175	2566577..2566669	-	93	WP_080279241.1	DUF3265 domain-containing protein	-
PWW24_RS12180	2566696..2567205	-	510	WP_239947574.1	hypothetical protein	-
PWW24_RS12185	2567251..2567343	-	93	WP_077681052.1	DUF3265 domain-containing protein	-
PWW24_RS12190	2567377..2567733	-	357	WP_020198239.1	hypothetical protein	-
PWW24_RS12195	2567802..2567894	-	93	WP_080252672.1	DUF3265 domain-containing protein	-
PWW24_RS12200	2567915..2568532	-	618	WP_063344807.1	LysE family translocator	-
PWW24_RS12205	2568616..2568678	-	63	Protein_2326	DUF3265 domain-containing protein	-
PWW24_RS12210	2568675..2568998	-	324	WP_005536953.1	hypothetical protein	-
PWW24_RS12215	2569026..2569136	-	111	WP_231570825.1	DUF3265 domain-containing protein	-
PWW24_RS12220	2569193..2569441	+	249	WP_005377003.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
PWW24_RS12225	2569431..2569721	+	291	WP_045382929.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PWW24_RS12230	2569740..2569829	-	90	WP_071881309.1	DUF3265 domain-containing protein	-
PWW24_RS12235	2569847..2570125	-	279	WP_038886177.1	hypothetical protein	-
PWW24_RS12240	2570294..2571016	-	723	WP_274882193.1	hypothetical protein	-
PWW24_RS12245	2571160..2571945	-	786	WP_274882194.1	hypothetical protein	-
PWW24_RS12250	2572689..2573336	-	648	WP_274882195.1	glutathione S-transferase	-
PWW24_RS12255	2573382..2573474	-	93	WP_200885265.1	DUF3265 domain-containing protein	-
PWW24_RS12260	2573489..2574121	-	633	WP_045604826.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	2515422..2589184	73762
	-	inside	Integron	-	-	2522581..2589184	66603

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-86)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (12-75)

Sequences

Toxin

Protein

• Length: 97 a.a.
• Molecular weight: 11273.31 Da
• Isoelectric Point: 10.5932

>T273261 WP_045382929.1 NZ_CP118590:2569431-2569721 [Vibrio harveyi]
MIYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Nucleotide

• Length: 291 bp

Antitoxin

Protein

• Length: 83 a.a.
• Molecular weight: 9079.37 Da
• Isoelectric Point: 3.9610

>AT273261 WP_005377003.1 NZ_CP118590:2569193-2569441 [Vibrio harveyi]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Nucleotide

• Length: 249 bp

Structures

Antitoxin

• AlphaFold DB: A0A347UR02