Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2555412..2555971 Replicon chromosome
Accession NZ_CP118590
Organism Vibrio harveyi strain fish12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW24_RS12050 Protein ID WP_274882184.1
Coordinates 2555693..2555971 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PWW24_RS12045 Protein ID WP_274882183.1
Coordinates 2555412..2555696 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW24_RS11990 2550981..2551070 - 90 WP_072611848.1 DUF3265 domain-containing protein -
PWW24_RS11995 2551088..2551774 - 687 WP_199450652.1 HNH endonuclease -
PWW24_RS12000 2551843..2551935 - 93 Protein_2285 DUF3265 domain-containing protein -
PWW24_RS12005 2551950..2552354 - 405 WP_213971719.1 hypothetical protein -
PWW24_RS12010 2552356..2553282 - 927 WP_072615077.1 AAA family ATPase -
PWW24_RS12015 2553330..2553419 - 90 WP_140280429.1 DUF3265 domain-containing protein -
PWW24_RS12020 2553445..2553984 - 540 WP_274882181.1 hypothetical protein -
PWW24_RS12025 2554023..2554112 - 90 WP_075984317.1 DUF3265 domain-containing protein -
PWW24_RS12030 2554130..2554627 - 498 WP_274882182.1 DNA topology modulation protein -
PWW24_RS12035 2554777..2555259 - 483 WP_155414574.1 hypothetical protein -
PWW24_RS12040 2555244..2555335 - 92 Protein_2293 DUF3265 domain-containing protein -
PWW24_RS12045 2555412..2555696 + 285 WP_274882183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW24_RS12050 2555693..2555971 + 279 WP_274882184.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW24_RS12055 2556108..2556767 - 660 WP_140388274.1 HAD family hydrolase -
PWW24_RS12060 2557223..2557627 - 405 WP_274882185.1 hypothetical protein -
PWW24_RS12065 2558167..2558640 - 474 WP_227740521.1 DUF4476 domain-containing protein -
PWW24_RS12070 2558675..2558767 - 93 WP_079856868.1 DUF3265 domain-containing protein -
PWW24_RS12075 2559130..2559324 - 195 WP_274882186.1 hypothetical protein -
PWW24_RS12080 2559422..2559513 - 92 Protein_2301 DUF3265 domain-containing protein -
PWW24_RS12085 2559528..2560253 - 726 WP_274882187.1 TIGR02391 family protein -
PWW24_RS12090 2560395..2560487 - 93 WP_004418565.1 DUF3265 domain-containing protein -
PWW24_RS12095 2560512..2560883 - 372 WP_045402250.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2515422..2589184 73762
- inside Integron - - 2522581..2589184 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(1-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10919.59 Da        Isoelectric Point: 4.3430

>T273260 WP_274882184.1 NZ_CP118590:2555693-2555971 [Vibrio harveyi]
MILWEEESLNDRERIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11085.40 Da        Isoelectric Point: 9.2167

>AT273260 WP_274882183.1 NZ_CP118590:2555412-2555696 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTSKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References