Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2531491..2532050 Replicon chromosome
Accession NZ_CP118590
Organism Vibrio harveyi strain fish12

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWW24_RS11765 Protein ID WP_005398411.1
Coordinates 2531772..2532050 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW24_RS11760 Protein ID WP_005398409.1
Coordinates 2531491..2531775 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW24_RS11690 2526625..2527173 - 549 WP_203346253.1 hypothetical protein -
PWW24_RS11695 2527447..2527755 + 309 WP_274791737.1 hypothetical protein -
PWW24_RS11700 2527765..2528133 + 369 WP_274791736.1 HNH endonuclease signature motif containing protein -
PWW24_RS11705 2528206..2528325 - 120 WP_080573781.1 DUF3265 domain-containing protein -
PWW24_RS11710 2528322..2528765 - 444 WP_103155411.1 hypothetical protein -
PWW24_RS11715 2528796..2528885 - 90 WP_072615037.1 DUF3265 domain-containing protein -
PWW24_RS11720 2528903..2529292 - 390 WP_274791735.1 DUF4345 domain-containing protein -
PWW24_RS11725 2529332..2529424 - 93 WP_206635068.1 DUF3265 domain-containing protein -
PWW24_RS11730 2529445..2530176 - 732 WP_274791734.1 hypothetical protein -
PWW24_RS11735 2530265..2530333 - 69 Protein_2232 DUF3265 domain-containing protein -
PWW24_RS11740 2530337..2530603 - 267 WP_029863890.1 hypothetical protein -
PWW24_RS11745 2530707..2530796 - 90 WP_076665001.1 DUF3265 domain-containing protein -
PWW24_RS11750 2530848..2531273 - 426 WP_069525414.1 hypothetical protein -
PWW24_RS11755 2531323..2531414 - 92 Protein_2236 DUF3265 domain-containing protein -
PWW24_RS11760 2531491..2531775 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW24_RS11765 2531772..2532050 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW24_RS11770 2532079..2532171 - 93 WP_196229928.1 DUF3265 domain-containing protein -
PWW24_RS11775 2532199..2532642 - 444 WP_017190363.1 hypothetical protein -
PWW24_RS11780 2532626..2532970 - 345 WP_017190364.1 hypothetical protein -
PWW24_RS11785 2533075..2533167 - 93 WP_079764584.1 DUF3265 domain-containing protein -
PWW24_RS11790 2533258..2533530 - 273 WP_009698352.1 hypothetical protein -
PWW24_RS11795 2533643..2534329 - 687 WP_047517854.1 GIY-YIG nuclease family protein -
PWW24_RS11800 2534357..2534446 - 90 WP_201258222.1 DUF3265 domain-containing protein -
PWW24_RS11805 2534464..2534916 - 453 WP_274791732.1 hypothetical protein -
PWW24_RS11810 2534942..2535031 - 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW24_RS11815 2535516..2535950 - 435 WP_274791731.1 GNAT family N-acetyltransferase -
PWW24_RS11820 2535981..2536073 - 93 WP_199436720.1 DUF3265 domain-containing protein -
PWW24_RS11825 2536109..2536528 - 420 WP_077200592.1 hypothetical protein -
PWW24_RS11830 2536622..2536714 - 93 WP_274882176.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2515422..2589184 73762
- inside Integron - - 2522581..2589184 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273259 WP_005398411.1 NZ_CP118590:2531772-2532050 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273259 WP_005398409.1 NZ_CP118590:2531491-2531775 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References