Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2520947..2521494 Replicon chromosome
Accession NZ_CP118590
Organism Vibrio harveyi strain fish12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW24_RS11630 Protein ID WP_258455559.1
Coordinates 2520947..2521249 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A454B3H2
Locus tag PWW24_RS11635 Protein ID WP_005445660.1
Coordinates 2521237..2521494 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW24_RS11595 2516517..2516762 - 246 WP_222326331.1 hypothetical protein -
PWW24_RS11600 2517428..2517679 - 252 WP_017817975.1 DUF2442 domain-containing protein -
PWW24_RS11605 2518926..2519357 - 432 WP_045490299.1 GNAT family N-acetyltransferase -
PWW24_RS11610 2519565..2519981 - 417 WP_274791743.1 hypothetical protein -
PWW24_RS11615 2520037..2520156 - 120 WP_080585338.1 DUF3265 domain-containing protein -
PWW24_RS11620 2520150..2520422 - 273 WP_050903611.1 hypothetical protein -
PWW24_RS11625 2520751..2520903 + 153 Protein_2210 IS30 family transposase -
PWW24_RS11630 2520947..2521249 - 303 WP_258455559.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW24_RS11635 2521237..2521494 - 258 WP_005445660.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW24_RS11640 2521693..2521848 - 156 WP_017190350.1 hypothetical protein -
PWW24_RS11645 2521845..2522024 - 180 WP_017190351.1 hypothetical protein -
PWW24_RS11650 2522062..2522286 - 225 WP_274791742.1 BrnT family toxin -
PWW24_RS11655 2522581..2523024 - 444 WP_274791741.1 GNAT family N-acetyltransferase -
PWW24_RS11660 2523161..2523229 - 69 Protein_2217 DUF3265 domain-containing protein -
PWW24_RS11665 2523226..2523525 - 300 WP_005536942.1 hypothetical protein -
PWW24_RS11670 2523664..2525049 - 1386 WP_274791740.1 hypothetical protein -
PWW24_RS11675 2525209..2525874 - 666 WP_274791739.1 hypothetical protein -
PWW24_RS11680 2525905..2525997 - 93 WP_079750026.1 DUF3265 domain-containing protein -
PWW24_RS11685 2526116..2526325 - 210 WP_274882175.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2515422..2589184 73762
- inside Integron - - 2522581..2589184 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11623.59 Da        Isoelectric Point: 7.9971

>T273258 WP_258455559.1 NZ_CP118590:c2521249-2520947 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9548.06 Da        Isoelectric Point: 7.3177

>AT273258 WP_005445660.1 NZ_CP118590:c2521494-2521237 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKGKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A454B3H2

References