Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 2553834..2554362 Replicon chromosome
Accession NZ_CP118586
Organism Vibrio harveyi strain fish6

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW23_RS12030 Protein ID WP_045382929.1
Coordinates 2554072..2554362 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PWW23_RS12025 Protein ID WP_005377003.1
Coordinates 2553834..2554082 (+) Length 83 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW23_RS11955 2549279..2549848 - 570 WP_274882190.1 hypothetical protein -
PWW23_RS11960 2549950..2550012 - 63 Protein_2281 DUF3265 domain-containing protein -
PWW23_RS11965 2550003..2550434 - 432 WP_155487907.1 hypothetical protein -
PWW23_RS11970 2550464..2550556 - 93 WP_274882191.1 DUF3265 domain-containing protein -
PWW23_RS11975 2550589..2551110 - 522 WP_274882192.1 hypothetical protein -
PWW23_RS11980 2551218..2551310 - 93 WP_080279241.1 DUF3265 domain-containing protein -
PWW23_RS11985 2551337..2551846 - 510 WP_239947574.1 hypothetical protein -
PWW23_RS11990 2551892..2551984 - 93 WP_077681052.1 DUF3265 domain-containing protein -
PWW23_RS11995 2552018..2552374 - 357 WP_020198239.1 hypothetical protein -
PWW23_RS12000 2552443..2552535 - 93 WP_080252672.1 DUF3265 domain-containing protein -
PWW23_RS12005 2552556..2553173 - 618 WP_063344807.1 LysE family translocator -
PWW23_RS12010 2553257..2553319 - 63 Protein_2291 DUF3265 domain-containing protein -
PWW23_RS12015 2553316..2553639 - 324 WP_005536953.1 hypothetical protein -
PWW23_RS12020 2553667..2553777 - 111 WP_231570825.1 DUF3265 domain-containing protein -
PWW23_RS12025 2553834..2554082 + 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW23_RS12030 2554072..2554362 + 291 WP_045382929.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW23_RS12035 2554381..2554470 - 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW23_RS12040 2554488..2554766 - 279 WP_038886177.1 hypothetical protein -
PWW23_RS12045 2554935..2555657 - 723 WP_274882193.1 hypothetical protein -
PWW23_RS12050 2555801..2556586 - 786 WP_274882194.1 hypothetical protein -
PWW23_RS12055 2557330..2557977 - 648 WP_274882195.1 glutathione S-transferase -
PWW23_RS12060 2558023..2558115 - 93 WP_200885265.1 DUF3265 domain-containing protein -
PWW23_RS12065 2558130..2558762 - 633 WP_045604826.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2500063..2573825 73762
- inside Integron - - 2507222..2573825 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 97 a.a.        Molecular weight: 11273.31 Da        Isoelectric Point: 10.5932

>T273257 WP_045382929.1 NZ_CP118586:2554072-2554362 [Vibrio harveyi]
MIYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp


Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT273257 WP_005377003.1 NZ_CP118586:2553834-2554082 [Vibrio harveyi]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References