Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2540053..2540612 Replicon chromosome
Accession NZ_CP118586
Organism Vibrio harveyi strain fish6

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW23_RS11855 Protein ID WP_274882184.1
Coordinates 2540334..2540612 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PWW23_RS11850 Protein ID WP_274882183.1
Coordinates 2540053..2540337 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW23_RS11795 2535622..2535711 - 90 WP_072611848.1 DUF3265 domain-containing protein -
PWW23_RS11800 2535729..2536415 - 687 WP_199450652.1 HNH endonuclease -
PWW23_RS11805 2536484..2536576 - 93 Protein_2250 DUF3265 domain-containing protein -
PWW23_RS11810 2536591..2536995 - 405 WP_213971719.1 hypothetical protein -
PWW23_RS11815 2536997..2537923 - 927 WP_072615077.1 AAA family ATPase -
PWW23_RS11820 2537971..2538060 - 90 WP_140280429.1 DUF3265 domain-containing protein -
PWW23_RS11825 2538086..2538625 - 540 WP_274882181.1 hypothetical protein -
PWW23_RS11830 2538664..2538753 - 90 WP_075984317.1 DUF3265 domain-containing protein -
PWW23_RS11835 2538771..2539268 - 498 WP_274882182.1 DNA topology modulation protein -
PWW23_RS11840 2539418..2539900 - 483 WP_155414574.1 hypothetical protein -
PWW23_RS11845 2539885..2539976 - 92 Protein_2258 DUF3265 domain-containing protein -
PWW23_RS11850 2540053..2540337 + 285 WP_274882183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW23_RS11855 2540334..2540612 + 279 WP_274882184.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW23_RS11860 2540749..2541408 - 660 WP_140388274.1 HAD family hydrolase -
PWW23_RS11865 2541864..2542268 - 405 WP_274882185.1 hypothetical protein -
PWW23_RS11870 2542808..2543281 - 474 WP_227740521.1 DUF4476 domain-containing protein -
PWW23_RS11875 2543316..2543408 - 93 WP_079856868.1 DUF3265 domain-containing protein -
PWW23_RS11880 2543771..2543965 - 195 WP_274882186.1 hypothetical protein -
PWW23_RS11885 2544063..2544154 - 92 Protein_2266 DUF3265 domain-containing protein -
PWW23_RS11890 2544169..2544894 - 726 WP_274882187.1 TIGR02391 family protein -
PWW23_RS11895 2545036..2545128 - 93 WP_004418565.1 DUF3265 domain-containing protein -
PWW23_RS11900 2545153..2545524 - 372 WP_045402250.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2500063..2573825 73762
- inside Integron - - 2507222..2573825 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(1-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10919.59 Da        Isoelectric Point: 4.3430

>T273256 WP_274882184.1 NZ_CP118586:2540334-2540612 [Vibrio harveyi]
MILWEEESLNDRERIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11085.40 Da        Isoelectric Point: 9.2167

>AT273256 WP_274882183.1 NZ_CP118586:2540053-2540337 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTSKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References