Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2516132..2516691 Replicon chromosome
Accession NZ_CP118586
Organism Vibrio harveyi strain fish6

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWW23_RS11570 Protein ID WP_005398411.1
Coordinates 2516413..2516691 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW23_RS11565 Protein ID WP_005398409.1
Coordinates 2516132..2516416 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW23_RS11495 2511266..2511814 - 549 WP_203346253.1 hypothetical protein -
PWW23_RS11500 2512088..2512396 + 309 WP_274791737.1 hypothetical protein -
PWW23_RS11505 2512406..2512774 + 369 WP_274791736.1 HNH endonuclease signature motif containing protein -
PWW23_RS11510 2512847..2512966 - 120 WP_080573781.1 DUF3265 domain-containing protein -
PWW23_RS11515 2512963..2513406 - 444 WP_103155411.1 hypothetical protein -
PWW23_RS11520 2513437..2513526 - 90 WP_072615037.1 DUF3265 domain-containing protein -
PWW23_RS11525 2513544..2513933 - 390 WP_274791735.1 DUF4345 domain-containing protein -
PWW23_RS11530 2513973..2514065 - 93 WP_206635068.1 DUF3265 domain-containing protein -
PWW23_RS11535 2514086..2514817 - 732 WP_274791734.1 hypothetical protein -
PWW23_RS11540 2514906..2514974 - 69 Protein_2197 DUF3265 domain-containing protein -
PWW23_RS11545 2514978..2515244 - 267 WP_029863890.1 hypothetical protein -
PWW23_RS11550 2515348..2515437 - 90 WP_076665001.1 DUF3265 domain-containing protein -
PWW23_RS11555 2515489..2515914 - 426 WP_069525414.1 hypothetical protein -
PWW23_RS11560 2515964..2516055 - 92 Protein_2201 DUF3265 domain-containing protein -
PWW23_RS11565 2516132..2516416 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW23_RS11570 2516413..2516691 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW23_RS11575 2516720..2516812 - 93 WP_196229928.1 DUF3265 domain-containing protein -
PWW23_RS11580 2516840..2517283 - 444 WP_017190363.1 hypothetical protein -
PWW23_RS11585 2517267..2517611 - 345 WP_017190364.1 hypothetical protein -
PWW23_RS11590 2517716..2517808 - 93 WP_079764584.1 DUF3265 domain-containing protein -
PWW23_RS11595 2517899..2518171 - 273 WP_009698352.1 hypothetical protein -
PWW23_RS11600 2518284..2518970 - 687 WP_047517854.1 GIY-YIG nuclease family protein -
PWW23_RS11605 2518998..2519087 - 90 WP_201258222.1 DUF3265 domain-containing protein -
PWW23_RS11610 2519105..2519557 - 453 WP_274791732.1 hypothetical protein -
PWW23_RS11615 2519583..2519672 - 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW23_RS11620 2520157..2520591 - 435 WP_274791731.1 GNAT family N-acetyltransferase -
PWW23_RS11625 2520622..2520714 - 93 WP_199436720.1 DUF3265 domain-containing protein -
PWW23_RS11630 2520750..2521169 - 420 WP_077200592.1 hypothetical protein -
PWW23_RS11635 2521263..2521355 - 93 WP_274882176.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2500063..2573825 73762
- inside Integron - - 2507222..2573825 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273255 WP_005398411.1 NZ_CP118586:2516413-2516691 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273255 WP_005398409.1 NZ_CP118586:2516132-2516416 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References