Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2505588..2506135 Replicon chromosome
Accession NZ_CP118586
Organism Vibrio harveyi strain fish6

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW23_RS11435 Protein ID WP_258455559.1
Coordinates 2505588..2505890 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A454B3H2
Locus tag PWW23_RS11440 Protein ID WP_005445660.1
Coordinates 2505878..2506135 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW23_RS11400 2501158..2501403 - 246 WP_222326331.1 hypothetical protein -
PWW23_RS11405 2502069..2502320 - 252 WP_017817975.1 DUF2442 domain-containing protein -
PWW23_RS11410 2503567..2503998 - 432 WP_045490299.1 GNAT family N-acetyltransferase -
PWW23_RS11415 2504206..2504622 - 417 WP_274791743.1 hypothetical protein -
PWW23_RS11420 2504678..2504797 - 120 WP_080585338.1 DUF3265 domain-containing protein -
PWW23_RS11425 2504791..2505063 - 273 WP_050903611.1 hypothetical protein -
PWW23_RS11430 2505392..2505544 + 153 Protein_2175 IS30 family transposase -
PWW23_RS11435 2505588..2505890 - 303 WP_258455559.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW23_RS11440 2505878..2506135 - 258 WP_005445660.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW23_RS11445 2506334..2506489 - 156 WP_017190350.1 hypothetical protein -
PWW23_RS11450 2506486..2506665 - 180 WP_017190351.1 hypothetical protein -
PWW23_RS11455 2506703..2506927 - 225 WP_274791742.1 BrnT family toxin -
PWW23_RS11460 2507222..2507665 - 444 WP_274791741.1 GNAT family N-acetyltransferase -
PWW23_RS11465 2507802..2507870 - 69 Protein_2182 DUF3265 domain-containing protein -
PWW23_RS11470 2507867..2508166 - 300 WP_005536942.1 hypothetical protein -
PWW23_RS11475 2508305..2509690 - 1386 WP_274791740.1 hypothetical protein -
PWW23_RS11480 2509850..2510515 - 666 WP_274791739.1 hypothetical protein -
PWW23_RS11485 2510546..2510638 - 93 WP_079750026.1 DUF3265 domain-containing protein -
PWW23_RS11490 2510757..2510966 - 210 WP_274882175.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2500063..2573825 73762
- inside Integron - - 2507222..2573825 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11623.59 Da        Isoelectric Point: 7.9971

>T273254 WP_258455559.1 NZ_CP118586:c2505890-2505588 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9548.06 Da        Isoelectric Point: 7.3177

>AT273254 WP_005445660.1 NZ_CP118586:c2506135-2505878 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKGKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A454B3H2

References