Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2505588..2506135 | Replicon | chromosome |
| Accession | NZ_CP118586 | ||
| Organism | Vibrio harveyi strain fish6 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PWW23_RS11435 | Protein ID | WP_258455559.1 |
| Coordinates | 2505588..2505890 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A454B3H2 |
| Locus tag | PWW23_RS11440 | Protein ID | WP_005445660.1 |
| Coordinates | 2505878..2506135 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWW23_RS11400 | 2501158..2501403 | - | 246 | WP_222326331.1 | hypothetical protein | - |
| PWW23_RS11405 | 2502069..2502320 | - | 252 | WP_017817975.1 | DUF2442 domain-containing protein | - |
| PWW23_RS11410 | 2503567..2503998 | - | 432 | WP_045490299.1 | GNAT family N-acetyltransferase | - |
| PWW23_RS11415 | 2504206..2504622 | - | 417 | WP_274791743.1 | hypothetical protein | - |
| PWW23_RS11420 | 2504678..2504797 | - | 120 | WP_080585338.1 | DUF3265 domain-containing protein | - |
| PWW23_RS11425 | 2504791..2505063 | - | 273 | WP_050903611.1 | hypothetical protein | - |
| PWW23_RS11430 | 2505392..2505544 | + | 153 | Protein_2175 | IS30 family transposase | - |
| PWW23_RS11435 | 2505588..2505890 | - | 303 | WP_258455559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWW23_RS11440 | 2505878..2506135 | - | 258 | WP_005445660.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PWW23_RS11445 | 2506334..2506489 | - | 156 | WP_017190350.1 | hypothetical protein | - |
| PWW23_RS11450 | 2506486..2506665 | - | 180 | WP_017190351.1 | hypothetical protein | - |
| PWW23_RS11455 | 2506703..2506927 | - | 225 | WP_274791742.1 | BrnT family toxin | - |
| PWW23_RS11460 | 2507222..2507665 | - | 444 | WP_274791741.1 | GNAT family N-acetyltransferase | - |
| PWW23_RS11465 | 2507802..2507870 | - | 69 | Protein_2182 | DUF3265 domain-containing protein | - |
| PWW23_RS11470 | 2507867..2508166 | - | 300 | WP_005536942.1 | hypothetical protein | - |
| PWW23_RS11475 | 2508305..2509690 | - | 1386 | WP_274791740.1 | hypothetical protein | - |
| PWW23_RS11480 | 2509850..2510515 | - | 666 | WP_274791739.1 | hypothetical protein | - |
| PWW23_RS11485 | 2510546..2510638 | - | 93 | WP_079750026.1 | DUF3265 domain-containing protein | - |
| PWW23_RS11490 | 2510757..2510966 | - | 210 | WP_274882175.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2500063..2573825 | 73762 | |
| - | inside | Integron | - | - | 2507222..2573825 | 66603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11623.59 Da Isoelectric Point: 7.9971
>T273254 WP_258455559.1 NZ_CP118586:c2505890-2505588 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|