Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1588836..1589395 Replicon chromosome
Accession NZ_CP118584
Organism Vibrio harveyi strain fish5

Toxin (Protein)


Gene name relE Uniprot ID A0A2K7SRU8
Locus tag PWW25_RS07180 Protein ID WP_017035198.1
Coordinates 1589117..1589395 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW25_RS07175 Protein ID WP_005398409.1
Coordinates 1588836..1589120 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW25_RS07110 1584125..1584307 - 183 WP_171386667.1 hypothetical protein -
PWW25_RS07115 1584436..1584525 - 90 WP_079386180.1 DUF3265 domain-containing protein -
PWW25_RS07120 1584552..1584725 - 174 WP_180825088.1 hypothetical protein -
PWW25_RS07125 1584955..1585071 - 117 WP_274877082.1 DUF3265 domain-containing protein -
PWW25_RS07130 1585062..1585835 - 774 WP_274876998.1 NERD domain-containing protein -
PWW25_RS07135 1585864..1585956 - 93 WP_080765011.1 DUF3265 domain-containing protein -
PWW25_RS07140 1585971..1586327 - 357 WP_045396955.1 hypothetical protein -
PWW25_RS07145 1586363..1586492 - 130 Protein_1387 DUF3265 domain-containing protein -
PWW25_RS07150 1587006..1587434 - 429 WP_274876999.1 GNAT family N-acetyltransferase -
PWW25_RS07155 1587577..1587966 - 390 WP_050937670.1 hypothetical protein -
PWW25_RS07160 1587998..1588090 - 93 Protein_1390 DUF3265 domain-containing protein -
PWW25_RS07165 1588113..1588643 - 531 WP_274877000.1 hypothetical protein -
PWW25_RS07170 1588668..1588759 - 92 Protein_1392 DUF3265 domain-containing protein -
PWW25_RS07175 1588836..1589120 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW25_RS07180 1589117..1589395 + 279 WP_017035198.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW25_RS07185 1589424..1589516 - 93 WP_080765011.1 DUF3265 domain-containing protein -
PWW25_RS07190 1589531..1589887 - 357 WP_274877001.1 hypothetical protein -
PWW25_RS07195 1590038..1590580 - 543 WP_274876993.1 hypothetical protein -
PWW25_RS07200 1590609..1590701 - 93 WP_193785459.1 DUF3265 domain-containing protein -
PWW25_RS07205 1590765..1591058 - 294 WP_005448137.1 hypothetical protein -
PWW25_RS07210 1591147..1591221 - 75 Protein_1400 DUF3265 domain-containing protein -
PWW25_RS07215 1591236..1591994 - 759 WP_274877002.1 hypothetical protein -
PWW25_RS07220 1592023..1592151 - 129 WP_099098883.1 DUF3265 domain-containing protein -
PWW25_RS07225 1592570..1592662 - 93 WP_005433818.1 DUF3265 domain-containing protein -
PWW25_RS07230 1592677..1593369 - 693 WP_031823008.1 DUF4145 domain-containing protein -
PWW25_RS07235 1593402..1593491 - 90 WP_072829120.1 DUF3265 domain-containing protein -
PWW25_RS07240 1593620..1593943 + 324 WP_274877003.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1552588..1632942 80354
- inside Integron - - 1556911..1632942 76031


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10905.60 Da        Isoelectric Point: 4.3430

>T273252 WP_017035198.1 NZ_CP118584:1589117-1589395 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWIEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273252 WP_005398409.1 NZ_CP118584:1588836-1589120 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SRU8

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References