Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2628003..2628562 Replicon chromosome
Accession NZ_CP118582
Organism Vibrio harveyi strain fish4

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWW29_RS12150 Protein ID WP_005398411.1
Coordinates 2628284..2628562 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW29_RS12145 Protein ID WP_005398409.1
Coordinates 2628003..2628287 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW29_RS12080 2623855..2624157 - 303 WP_025548916.1 type II toxin-antitoxin system RelE/ParE family toxin -
PWW29_RS12085 2624145..2624402 - 258 WP_274882991.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PWW29_RS12090 2624484..2624573 - 90 WP_079766096.1 DUF3265 domain-containing protein -
PWW29_RS12095 2625094..2625186 - 93 WP_077681052.1 DUF3265 domain-containing protein -
PWW29_RS12100 2625212..2625673 - 462 WP_274882993.1 hypothetical protein -
PWW29_RS12105 2625760..2625852 - 93 WP_004418565.1 DUF3265 domain-containing protein -
PWW29_RS12110 2625944..2626216 - 273 WP_050933366.1 hypothetical protein -
PWW29_RS12115 2626362..2626775 - 414 WP_274882995.1 RDD family protein -
PWW29_RS12120 2626827..2626919 - 93 WP_079879139.1 DUF3265 domain-containing protein -
PWW29_RS12125 2626952..2627197 - 246 WP_017449587.1 hypothetical protein -
PWW29_RS12130 2627298..2627390 - 93 WP_122067392.1 DUF3265 domain-containing protein -
PWW29_RS12135 2627405..2627809 - 405 WP_122067391.1 hypothetical protein -
PWW29_RS12140 2627836..2627926 - 91 Protein_2320 DUF3265 domain-containing protein -
PWW29_RS12145 2628003..2628287 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW29_RS12150 2628284..2628562 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW29_RS12155 2628591..2628683 - 93 WP_218918686.1 DUF3265 domain-containing protein -
PWW29_RS12160 2628698..2629105 - 408 WP_274883856.1 hypothetical protein -
PWW29_RS12165 2629057..2629665 - 609 WP_274882997.1 DUF2971 domain-containing protein -
PWW29_RS12170 2629817..2631628 - 1812 WP_274882999.1 P-loop NTPase fold protein -
PWW29_RS12175 2631664..2631774 - 111 WP_154581842.1 DUF3265 domain-containing protein -
PWW29_RS12180 2631771..2632313 - 543 WP_274883000.1 hypothetical protein -
PWW29_RS12185 2632359..2632451 - 93 WP_079852375.1 DUF3265 domain-containing protein -
PWW29_RS12190 2632478..2633155 - 678 WP_274883002.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2587125..2672578 85453
- inside Integron - - 2625212..2672578 47366


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273251 WP_005398411.1 NZ_CP118582:2628284-2628562 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273251 WP_005398409.1 NZ_CP118582:2628003-2628287 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References