Detailed information of TA system TA273250

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/Phd(antitoxin)
• Location: 2623855..2624402
• Replicon: chromosome
• Accession: NZ_CP118582
• Organism: Vibrio harveyi strain fish4

Toxin (Protein)

• Gene name: relE
• Uniprot ID: A0A347UR19
• Locus tag: PWW29_RS12080
• Protein ID: WP_025548916.1
• Coordinates: 2623855..2624157 (-)
• Length: 101 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: PWW29_RS12085
• Protein ID: WP_274882991.1
• Coordinates: 2624145..2624402 (-)
• Length: 86 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PWW29_RS12055	2619699..2620655	+	957	WP_274882966.1	IS110 family transposase	-
PWW29_RS12060	2620694..2621215	-	522	WP_171373173.1	GNAT family N-acetyltransferase	-
PWW29_RS12065	2621300..2621377	-	78	Protein_2305	DUF3265 domain-containing protein	-
PWW29_RS12070	2621776..2621868	-	93	WP_079857359.1	DUF3265 domain-containing protein	-
PWW29_RS12075	2622403..2623752	+	1350	WP_274882986.1	group II intron reverse transcriptase/maturase	-
PWW29_RS12080	2623855..2624157	-	303	WP_025548916.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PWW29_RS12085	2624145..2624402	-	258	WP_274882991.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
PWW29_RS12090	2624484..2624573	-	90	WP_079766096.1	DUF3265 domain-containing protein	-
PWW29_RS12095	2625094..2625186	-	93	WP_077681052.1	DUF3265 domain-containing protein	-
PWW29_RS12100	2625212..2625673	-	462	WP_274882993.1	hypothetical protein	-
PWW29_RS12105	2625760..2625852	-	93	WP_004418565.1	DUF3265 domain-containing protein	-
PWW29_RS12110	2625944..2626216	-	273	WP_050933366.1	hypothetical protein	-
PWW29_RS12115	2626362..2626775	-	414	WP_274882995.1	RDD family protein	-
PWW29_RS12120	2626827..2626919	-	93	WP_079879139.1	DUF3265 domain-containing protein	-
PWW29_RS12125	2626952..2627197	-	246	WP_017449587.1	hypothetical protein	-
PWW29_RS12130	2627298..2627390	-	93	WP_122067392.1	DUF3265 domain-containing protein	-
PWW29_RS12135	2627405..2627809	-	405	WP_122067391.1	hypothetical protein	-
PWW29_RS12140	2627836..2627926	-	91	Protein_2320	DUF3265 domain-containing protein	-
PWW29_RS12145	2628003..2628287	+	285	WP_005398409.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	-
PWW29_RS12150	2628284..2628562	+	279	WP_005398411.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	-
PWW29_RS12155	2628591..2628683	-	93	WP_218918686.1	DUF3265 domain-containing protein	-
PWW29_RS12160	2628698..2629105	-	408	WP_274883856.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	2587125..2672578	85453
	-	flank	IS/Tn	-	-	2619699..2620655	956
	-	inside	Integron	-	-	2625212..2672578	47366

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-86)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-73)

Sequences

Toxin

Protein

• Length: 101 a.a.
• Molecular weight: 11669.57 Da
• Isoelectric Point: 5.1765

>T273250 WP_025548916.1 NZ_CP118582:c2624157-2623855 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Nucleotide

• Length: 303 bp

Antitoxin

Protein

• Length: 86 a.a.
• Molecular weight: 9654.16 Da
• Isoelectric Point: 6.7269

>AT273250 WP_274882991.1 NZ_CP118582:c2624402-2624145 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALSDGKMVSHDEAKDKM
SKWLK

Nucleotide

• Length: 258 bp

Structures

Toxin

• AlphaFold DB: A0A347UR19