Detailed information of TA system TA273249

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-YafN
• Location: 2719854..2720382
• Replicon: chromosome
• Accession: NZ_CP118580
• Organism: Vibrio harveyi strain fish3

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: PWW32_RS12905
• Protein ID: WP_045382929.1
• Coordinates: 2720092..2720382 (+)
• Length: 97 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: A0A347UR02
• Locus tag: PWW32_RS12900
• Protein ID: WP_005377003.1
• Coordinates: 2719854..2720102 (+)
• Length: 83 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PWW32_RS12830	2715299..2715868	-	570	WP_274882190.1	hypothetical protein	-
PWW32_RS12835	2715970..2716032	-	63	Protein_2446	DUF3265 domain-containing protein	-
PWW32_RS12840	2716023..2716454	-	432	WP_155487907.1	hypothetical protein	-
PWW32_RS12845	2716484..2716576	-	93	WP_274882191.1	DUF3265 domain-containing protein	-
PWW32_RS12850	2716609..2717130	-	522	WP_274882192.1	hypothetical protein	-
PWW32_RS12855	2717238..2717330	-	93	WP_080279241.1	DUF3265 domain-containing protein	-
PWW32_RS12860	2717357..2717866	-	510	WP_239947574.1	hypothetical protein	-
PWW32_RS12865	2717912..2718004	-	93	WP_077681052.1	DUF3265 domain-containing protein	-
PWW32_RS12870	2718038..2718394	-	357	WP_020198239.1	hypothetical protein	-
PWW32_RS12875	2718463..2718555	-	93	WP_080252672.1	DUF3265 domain-containing protein	-
PWW32_RS12880	2718576..2719193	-	618	WP_063344807.1	LysE family translocator	-
PWW32_RS12885	2719277..2719339	-	63	Protein_2456	DUF3265 domain-containing protein	-
PWW32_RS12890	2719336..2719659	-	324	WP_005536953.1	hypothetical protein	-
PWW32_RS12895	2719687..2719797	-	111	WP_231570825.1	DUF3265 domain-containing protein	-
PWW32_RS12900	2719854..2720102	+	249	WP_005377003.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
PWW32_RS12905	2720092..2720382	+	291	WP_045382929.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PWW32_RS12910	2720401..2720490	-	90	WP_071881309.1	DUF3265 domain-containing protein	-
PWW32_RS12915	2720508..2720786	-	279	WP_038886177.1	hypothetical protein	-
PWW32_RS12920	2720955..2721677	-	723	WP_274882193.1	hypothetical protein	-
PWW32_RS12925	2721821..2722606	-	786	WP_274882194.1	hypothetical protein	-
PWW32_RS12930	2723350..2723997	-	648	WP_274882195.1	glutathione S-transferase	-
PWW32_RS12935	2724043..2724135	-	93	WP_200885265.1	DUF3265 domain-containing protein	-
PWW32_RS12940	2724150..2724782	-	633	WP_045604826.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	2666083..2739845	73762
	-	inside	Integron	-	-	2673242..2739845	66603

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-86)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (12-75)

Sequences

Toxin

Protein

• Length: 97 a.a.
• Molecular weight: 11273.31 Da
• Isoelectric Point: 10.5932

>T273249 WP_045382929.1 NZ_CP118580:2720092-2720382 [Vibrio harveyi]
MIYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Nucleotide

• Length: 291 bp

Antitoxin

Protein

• Length: 83 a.a.
• Molecular weight: 9079.37 Da
• Isoelectric Point: 3.9610

>AT273249 WP_005377003.1 NZ_CP118580:2719854-2720102 [Vibrio harveyi]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Nucleotide

• Length: 249 bp

Structures

Antitoxin

• AlphaFold DB: A0A347UR02